KEGG   Homo sapiens (human): 7805Help
Entry
7805              CDS       T01001                                 

Gene name
LAPTM5, CLAST6
Definition
(RefSeq) lysosomal protein transmembrane 5
  KO
K12387  
lysosomal-associated transmembrane protein
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    7805 (LAPTM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34
AA seq 262 aa AA seqDB search
MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI
ADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAY
LKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP
HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYE
EALSLPSKTPEGGPAPPPYSEV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggacccccgcttgtccactgtccgccagacctgctgctgcttcaatgtccgcatcgca
accaccgccctggccatctaccatgtgatcatgagcgtcttgttgttcatcgagcactca
gtagaggtggcccatggcaaggcgtcctgcaagctctcccagatgggctacctcaggatc
gctgacctgatctccagcttcctgctcatcaccatgctcttcatcatcagcctgagccta
ctgatcggcgtagtcaagaaccgggagaagtacctgctgcccttcctgtccctgcaaatc
atggactatctcctgtgcctgctcaccctgctgggctcctacattgagctgcccgcctac
ctcaagttggcctcccggagccgtgctagctcctccaagttccccctgatgacgctgcag
ctgctggacttctgcctgagcatcctgaccctctgcagctcctacatggaagtgcccacc
tatctcaacttcaagtccatgaaccacatgaattacctccccagccaggaggatatgcct
cataaccagttcatcaagatgatgatcatcttttccatcgccttcatcactgtccttatc
ttcaaggtctacatgttcaagtgcgtgtggcggtgctacagattgatcaagtgcatgaac
tcggtggaggagaagagaaactccaagatgctccagaaggtggtcctgccgtcctacgag
gaagccctgtctttgccatcgaagaccccagaggggggcccagcaccacccccatactca
gaggtgtga

DBGET integrated database retrieval system