KEGG   Homo sapiens (human): 781Help
Entry
781               CDS       T01001                                 

Gene name
CACNA2D1, CACNA2, CACNL2A, CCHL2A, LINC01112, lncRNA-N3, MHS3
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 1
Orthology
K04858  
voltage-dependent calcium channel alpha-2/delta-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Drug target
Gabapentin: 
Pregabalin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    781 (CACNA2D1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    781 (CACNA2D1)
  Circulatory system
   04260 Cardiac muscle contraction
    781 (CACNA2D1)
   04261 Adrenergic signaling in cardiomyocytes
    781 (CACNA2D1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    781 (CACNA2D1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    781 (CACNA2D1)
   05414 Dilated cardiomyopathy (DCM)
    781 (CACNA2D1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   781 (CACNA2D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21-q22
AA seq 1091 aa AA seqDB search
MAAGCLLALTLTLFQSLLIGPSSEEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDI
YEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASN
EVVYYNAKDDLDPEKNDSEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVL
NELNWTSALDEVFKKNREEDPSLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRR
RPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIML
FTDGGEERAQEIFNKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIR
INTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNITGQFENKTNLK
NQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTL
DFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSL
ALVLPTYSFYYIKAKLEETITQARSKKGKMKDSETLKPDNFEESGYTFIAPRDYCNDLKI
SDNNTEFLLNFNEFIDRKTPNNPSCNADLINRVLLDAGFTNELVQNYWSKQKNIKGVKAR
FVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGI
MVSKAVEIYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVI
LDDGGFLLMANHDDYTNQIGRFFGEIDPSLMRHLVNISVYAFNKSYDYQSVCEPGAAPKQ
GAGHRSAYVPSVADILQIGWWATAAAWSILQQFLLSLTFPRLLEAVEMEDDDFTASLSKQ
SCITEQTQYFFDNDSKSFSGVLDCGNCSRIFHGEKLMNTNLIFIMVESKGTCPCDTRLLI
QAEQTSDGPNPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPSLWYIIGIQFLLL
WLVSGSTHRLL
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggctgctggctgcctgctggccttgactctgacacttttccaatctttgctcatcggc
ccctcgtcggaggagccgttcccttcggccgtcactatcaaatcatgggtggataagatg
caagaagaccttgtcacactggcaaaaacagcaagtggagtcaatcagcttgttgatatt
tatgagaaatatcaagatttgtatactgtggaaccaaataatgcacgccagctggtagaa
attgcagccagggatattgagaaacttctgagcaacagatctaaagccctggtgcgcctg
gcattggaagcggagaaagttcaagcagctcaccagtggagagaagattttgcaagcaat
gaagttgtctactacaatgcaaaggatgatctcgatcctgagaaaaatgacagtgagcca
ggcagccagaggataaaacctgttttcattgaagatgctaattttggacgacaaatatct
tatcagcacgcagcagtccatattcctactgacatctatgagggctcaacaattgtgtta
aatgaactcaactggacaagtgccttagatgaagttttcaaaaagaatcgcgaggaagac
ccttcattattgtggcaggtttttggcagtgccactggcctagctcgatattatccagct
tcaccatgggttgataatagtagaactccaaataagattgacctttatgatgtacgcaga
agaccatggtacatccaaggagctgcatctcctaaagacatgcttattctggtggatgtg
agtggaagtgttagtggattgacacttaaactgatccgaacatctgtctccgaaatgtta
gaaaccctctcagatgatgatttcgtgaatgtagcttcatttaacagcaatgctcaggat
gtaagctgttttcagcaccttgtccaagcaaatgtaagaaataaaaaagtgttgaaagac
gcggtgaataatatcacagccaaaggaattacagattataagaagggctttagttttgct
tttgaacagctgcttaattataatgtttccagagcaaactgcaataagattattatgcta
ttcacggatggaggagaagagagagcccaggagatatttaacaaatacaataaagataaa
aaagtacgtgtattcacgttttcagttggtcaacacaattatgacagaggacctattcag
tggatggcctgtgaaaacaaaggttattattatgaaattccttccattggtgcaataaga
atcaatactcaggaatatttggatgttttgggaagaccaatggttttagcaggagacaaa
gctaagcaagtccaatggacaaatgtgtacctggatgcattggaactgggacttgtcatt
actggaactcttccggtcttcaacataaccggccaatttgaaaataagacaaacttaaag
aaccagctgattcttggtgtgatgggagtagatgtgtctttggaagatattaaaagactg
acaccacgttttacactgtgccccaatgggtattactttgcaatcgatcctaatggttat
gttttattacatccaaatcttcagccaaagaaccccaaatctcaggagccagtaacattg
gatttccttgatgcagagttagagaatgatattaaagtggagattcgaaataagatgatt
gatggggaaagtggagaaaaaacattcagaactctggttaaatctcaagatgagagatat
attgacaaaggaaacaggacatacacatggacacctgtcaatggcacagattacagtttg
gccttggtattaccaacctacagtttttactatataaaagccaaactagaagagacaata
actcaggccagatcaaaaaagggcaaaatgaaggattcggaaaccctgaagccagataat
tttgaagaatctggctatacattcatagcaccaagagattactgcaatgacctgaaaata
tcggataataacactgaatttcttttaaatttcaacgagtttattgatagaaaaactcca
aacaacccatcatgtaacgcggatttgattaatagagtcttgcttgatgcaggctttaca
aatgaacttgtccaaaattactggagtaagcagaaaaatatcaagggagtgaaagcacga
tttgttgtgactgatggtgggattaccagagtttatcccaaagaggctggagaaaattgg
caagaaaacccagagacatatgaggacagcttctataaaaggagcctagataatgataac
tatgttttcactgctccctactttaacaaaagtggacctggtgcctatgaatcgggcatt
atggtaagcaaagctgtagaaatatatattcaagggaaacttcttaaacctgcagttgtt
ggaattaaaattgatgtaaattcctggatagagaatttcaccaaaacctcaatcagagat
ccgtgtgctggtccagtttgtgactgcaaaagaaacagtgacgtaatggattgtgtgatt
ctggatgatggtgggtttcttctgatggcaaatcatgatgattatactaatcagattgga
agattttttggagagattgatcccagcttgatgagacacctggttaatatatcagtttat
gcttttaacaaatcttatgattatcagtcagtatgtgagcccggtgctgcaccaaaacaa
ggagcaggacatcgctcagcatatgtgccatcagtagcagacatattacaaattggctgg
tgggccactgctgctgcctggtctattctacagcagtttctcttgagtttgacctttcca
cgactccttgaggcagttgagatggaggatgatgacttcacggcctccctgtccaagcag
agctgcattactgaacaaacccagtatttcttcgataacgacagtaaatcattcagtggt
gtattagactgtggaaactgttccagaatctttcatggagaaaagcttatgaacaccaac
ttaatattcataatggttgagagcaaagggacatgtccatgtgacacacgactgctcata
caagcggagcagacttctgacggtccaaatccttgtgacatggttaagcaacccagatac
cgaaaagggcctgatgtctgctttgataacaatgtcttggaggattatactgactgtggt
ggtgtttctggattaaatccctccctgtggtatatcattggaatccagtttctactactt
tggctggtatctggcagcacacaccgcctgttatga

DBGET integrated database retrieval system