KEGG   Homo sapiens (human): 782Help
Entry
782               CDS       T01001                                 

Gene name
CACNB1, CAB1, CACNLB1, CCHLB1
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit beta 1
  KO
K04862  voltage-dependent calcium channel beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    782 (CACNB1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    782 (CACNB1)
  Circulatory system
   04260 Cardiac muscle contraction
    782 (CACNB1)
   04261 Adrenergic signaling in cardiomyocytes
    782 (CACNB1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    782 (CACNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    782 (CACNB1)
   05414 Dilated cardiomyopathy (DCM)
    782 (CACNB1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN beta
   782 (CACNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 782
NCBI-ProteinID: NP_000714
OMIM: 114207
HGNC: 1401
Ensembl: ENSG00000067191
Vega: OTTHUMG00000133217
Pharos: Q02641(Tdark)
UniProt: Q02641
Position
17q12
AA seq 598 aa AA seqDB search
MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LGSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGT
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggtccagaagaccagcatgtcccggggcccttacccaccctcccaggagatccccatg
gaggtcttcgaccccagcccgcagggcaaatacagcaagaggaaagggcgattcaaacgg
tcagatgggagcacgtcctcggataccacatccaacagctttgtccgccagggctcagcg
gagtcctacaccagccgtccatcagactctgatgtatctctggaggaggaccgggaagcc
ttaaggaaggaagcagagcgccaggcattagcgcagctcgagaaggccaagaccaagcca
gtggcatttgctgtgcggacaaatgttggctacaatccgtctccaggggatgaggtgcct
gtgcagggagtggccatcaccttcgagcccaaagacttcctgcacatcaaggagaaatac
aataatgactggtggatcgggcggctggtgaaggagggctgtgaggttggcttcattccc
agccccgtcaaactggacagccttcgcctgctgcaggaacagaagctgcgccagaaccgc
ctcggctccagcaaatcaggcgataactccagttccagtctgggagatgtggtgactggc
acccgccgccccacaccccctgccagtgccaaacagaagcagaagtcgacagagcatgtg
cccccctatgacgtggtgccttccatgaggcccatcatcctggtgggaccgtcgctcaag
ggctacgaggttacagacatgatgcagaaagctttatttgacttcttgaagcatcggttt
gatggcaggatctccatcactcgtgtgacggcagatatttccctggctaagcgctcagtt
ctcaacaaccccagcaaacacatcatcattgagcgctccaacacacgctccagcctggct
gaggtgcagagtgaaatcgagcgaatcttcgagctggcccggacccttcagttggtcgct
ctggatgctgacaccatcaatcacccagcccagctgtccaagacctcgctggcccccatc
attgtttacatcaagatcacctctcccaaggtacttcaaaggctcatcaagtcccgagga
aagtctcagtccaaacacctcaatgtccaaatagcggcctcggaaaagctggcacagtgc
ccccctgaaatgtttgacatcatcctggatgagaaccaattggaggatgcctgcgagcat
ctggcggagtacttggaagcctattggaaggccacacacccgcccagcagcacgccaccc
aatccgctgctgaaccgcaccatggctaccgcagccctggctgccagccctgcccctgtc
tccaacctccagggaccctaccttgcttccggggaccagccactggaacgggccaccggg
gagcacgccagcatgcacgagtacccaggggagctgggccagcccccaggcctttacccc
agcagccacccaccaggccgggcaggcacgctacgggcactgtcccgccaagacactttt
gatgccgacacccccggcagccgaaactctgcctacacggagctgggagactcatgtgtg
gacatggagactgacccctcagaggggccagggcttggagaccctgcagggggcggcacg
cccccagcccgacagggatcctgggaggacgaggaagaagactatgaggaagagctgacc
gacaaccggaaccggggccggaataaggcccgctactgcgctgagggtgggggtccagtt
ttggggcgcaacaagaatgagctggagggctggggacgaggcgtctacattcgctga

DBGET integrated database retrieval system