KEGG   Homo sapiens (human): 782Help
Entry
782               CDS       T01001                                 

Gene name
CACNB1, CAB1, CACNLB1, CCHLB1
Definition
calcium channel, voltage-dependent, beta 1 subunit
Orthology
K04862  
voltage-dependent calcium channel beta-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:hsa05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:hsa05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:hsa05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21-q22
AA seq 598 aa AA seqDB search
MVQKTSMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNR
LGSSKSGDNSSSSLGDVVTGTRRPTPPASAKQKQKSTEHVPPYDVVPSMRPIILVGPSLK
GYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLA
EVQSEIERIFELARTLQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRG
KSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPP
NPLLNRTMATAALAASPAPVSNLQGPYLASGDQPLERATGEHASMHEYPGELGQPPGLYP
SSHPPGRAGTLRALSRQDTFDADTPGSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGT
PPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggtccagaagaccagcatgtcccggggcccttacccaccctcccaggagatccccatg
gaggtcttcgaccccagcccgcagggcaaatacagcaagaggaaagggcgattcaaacgg
tcagatgggagcacgtcctcggataccacatccaacagctttgtccgccagggctcagcg
gagtcctacaccagccgtccatcagactctgatgtatctctggaggaggaccgggaagcc
ttaaggaaggaagcagagcgccaggcattagcgcagctcgagaaggccaagaccaagcca
gtggcatttgctgtgcggacaaatgttggctacaatccgtctccaggggatgaggtgcct
gtgcagggagtggccatcaccttcgagcccaaagacttcctgcacatcaaggagaaatac
aataatgactggtggatcgggcggctggtgaaggagggctgtgaggttggcttcattccc
agccccgtcaaactggacagccttcgcctgctgcaggaacagaagctgcgccagaaccgc
ctcggctccagcaaatcaggcgataactccagttccagtctgggagatgtggtgactggc
acccgccgccccacaccccctgccagtgccaaacagaagcagaagtcgacagagcatgtg
cccccctatgacgtggtgccttccatgaggcccatcatcctggtgggaccgtcgctcaag
ggctacgaggttacagacatgatgcagaaagctttatttgacttcttgaagcatcggttt
gatggcaggatctccatcactcgtgtgacggcagatatttccctggctaagcgctcagtt
ctcaacaaccccagcaaacacatcatcattgagcgctccaacacacgctccagcctggct
gaggtgcagagtgaaatcgagcgaatcttcgagctggcccggacccttcagttggtcgct
ctggatgctgacaccatcaatcacccagcccagctgtccaagacctcgctggcccccatc
attgtttacatcaagatcacctctcccaaggtacttcaaaggctcatcaagtcccgagga
aagtctcagtccaaacacctcaatgtccaaatagcggcctcggaaaagctggcacagtgc
ccccctgaaatgtttgacatcatcctggatgagaaccaattggaggatgcctgcgagcat
ctggcggagtacttggaagcctattggaaggccacacacccgcccagcagcacgccaccc
aatccgctgctgaaccgcaccatggctaccgcagccctggctgccagccctgcccctgtc
tccaacctccagggaccctaccttgcttccggggaccagccactggaacgggccaccggg
gagcacgccagcatgcacgagtacccaggggagctgggccagcccccaggcctttacccc
agcagccacccaccaggccgggcaggcacgctacgggcactgtcccgccaagacactttt
gatgccgacacccccggcagccgaaactctgcctacacggagctgggagactcatgtgtg
gacatggagactgacccctcagaggggccagggcttggagaccctgcagggggcggcacg
cccccagcccgacagggatcctgggaggacgaggaagaagactatgaggaagagctgacc
gacaaccggaaccggggccggaataaggcccgctactgcgctgagggtgggggtccagtt
ttggggcgcaacaagaatgagctggagggctggggacgaggcgtctacattcgctga

DBGET integrated database retrieval system