KEGG   Homo sapiens (human): 783Help
Entry
783               CDS       T01001                                 

Gene name
CACNB2, CACNLB2, CAVB2, MYSB
Definition
calcium channel, voltage-dependent, beta 2 subunit
Orthology
K04863  
voltage-dependent calcium channel beta-2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Disease
H00728  
Brugada syndrome (BRS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    783 (CACNB2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    783 (CACNB2)
  Circulatory system
   04260 Cardiac muscle contraction
    783 (CACNB2)
   04261 Adrenergic signaling in cardiomyocytes
    783 (CACNB2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    783 (CACNB2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    783 (CACNB2)
   05414 Dilated cardiomyopathy (DCM)
    783 (CACNB2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN beta
   783 (CACNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p12
AA seq 605 aa AA seqDB search
MQCCGLVHRRRVRVSYGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPV
AFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPS
PVKLENMRLQHEQRAKQGKFYSSKSGGNSSSSLGDIVPSSRKSTPPSSAIDIDATGLDAE
ENDIPANHRSPKPSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYE
VTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQ
SEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQ
AKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADYLEAYWKATHPPSSSLPNPL
LSRTLATSSLPLSPTLASNSQGSQGDQRTDRSAPIRSASQAEEEPSVEPVKKSQHRSSSS
APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASHRDHNHRDETH
GSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVISKKRNEAGEWNRD
VYIRQ
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgctgcgggctggtgcatcgccggcgagtacgggtgtcctatggttcggcagac
tcctacactagccgtccatccgattccgatgtatctctggaggaggaccgggaggcagtg
cgcagagaagcggagcggcaggcccaggcacagttggaaaaagcaaagacaaagcccgtt
gcatttgcggttcggacaaatgtcagctacagtgcggcccatgaagatgatgttccagtg
cctggcatggccatctcattcgaagcaaaagattttctgcatgttaaggaaaaatttaac
aatgactggtggatagggcgattggtaaaagaaggctgtgaaatcggattcattccaagc
ccagtcaaactagaaaacatgaggctgcagcatgaacagagagccaagcaagggaaattc
tactccagtaaatcaggaggaaattcatcatccagtttgggtgacatagtacctagttcc
agaaaatcaacacctccatcatctgctatagacatagatgctactggcttagatgcagaa
gaaaatgatattccagcaaaccaccgctcccctaaacccagtgcaaacagtgtaacgtca
ccccactccaaagagaaaagaatgcccttctttaagaagacagagcacactcctccgtat
gatgtggtaccttccatgcgaccagtggtcctagtgggcccttctctgaagggctacgag
gtcacagatatgatgcaaaaagcgctgtttgattttttaaaacacagatttgaagggcgg
atatccatcacaagggtcaccgctgacatctcgcttgccaaacgctcggtattaaacaat
cccagtaagcacgcaataatagaaagatccaacacaaggtcaagcttagcggaagttcag
agtgaaatcgaaaggatttttgaacttgcaagaacattgcagttggtggtccttgacgcg
gatacaattaatcatccagctcaactcagtaaaacctccttggcccctattatagtatat
gtaaagatttcttctcctaaggttttacaaaggttaataaaatctcgagggaaatctcaa
gctaaacacctcaacgtccagatggtagcagctgataaactggctcagtgtcctccagag
ctgttcgatgtgatcttggatgagaaccagcttgaggatgcctgtgagcaccttgccgac
tatctggaggcctactggaaggccacccatcctcccagcagtagcctccccaaccctctc
cttagccgtacattagccacttcaagtctgcctcttagccccaccctagcctctaattca
cagggttctcaaggtgatcagaggactgatcgctccgctcctatccgttctgcttcccaa
gctgaagaagaacctagtgtggaaccagtcaagaaatcccagcaccgctcttcctcctca
gccccacaccacaaccatcgcagtgggacaagtcgcggcctctccaggcaagagacattt
gactcggaaacccaggagagtcgagactctgcctacgtagagccaaaggaagattattcc
catgaccacgtggaccactatgcctcacaccgtgaccacaaccacagagacgagacccac
gggagcagtgaccacagacacagggagtcccggcaccgttcccgggacgtggatcgagag
caggaccacaacgagtgcaacaagcagcgcagccgtcataaatccaaggatcgctactgt
gaaaaggatggagaagtgatatcaaaaaaacggaatgaggctggggagtggaacagggat
gtttacatccgccaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system