KEGG   Homo sapiens (human): 784Help
Entry
784               CDS       T01001                                 

Gene name
CACNB3, CAB3, CACNLB3
Definition
calcium channel, voltage-dependent, beta 3 subunit
Orthology
K04864  
voltage-dependent calcium channel beta-3
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    784 (CACNB3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    784 (CACNB3)
  Circulatory system
   04260 Cardiac muscle contraction
    784 (CACNB3)
   04261 Adrenergic signaling in cardiomyocytes
    784 (CACNB3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    784 (CACNB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    784 (CACNB3)
   05414 Dilated cardiomyopathy (DCM)
    784 (CACNB3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN beta
   784 (CACNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q13
AA seq 484 aa AA seqDB search
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
HHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWP
KDSY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacgactcctacgtgcccgggtttgaggactcggaggcgggttcagccgactcc
tacaccagccgcccatctctggactcagacgtctccctggaggaggaccgggagagtgcc
cggcgtgaagtagagagccaggctcagcagcagctcgaaagggccaagcacaaacctgtg
gcatttgcggtgaggaccaatgtcagctactgtggcgtactggatgaggagtgcccagtc
cagggctctggagtcaactttgaggccaaagattttctgcacattaaagagaagtacagc
aatgactggtggatcgggcggctagtgaaagagggcggggacatcgccttcatccccagc
ccccagcgcctggagagcatccggctcaaacaggagcagaaggccaggagatctgggaac
ccttccagcctgagtgacattggcaaccgacgctcccctccgccatctctagccaagcag
aagcaaaagcaggcggaacatgttcccccatatgacgtggtgccctccatgcggcctgtg
gtgctggtgggaccctctctgaaaggttatgaggtcacagacatgatgcagaaggctctc
ttcgacttcctcaaacacagatttgatggcaggatctccatcacccgagtcacagccgac
ctctccctggcaaagcgatctgtgctcaacaatccgggcaagaggaccatcattgagcgc
tcctctgcccgctccagcattgcggaagtgcagagtgagatcgagcgcatatttgagctg
gccaaatccctgcagctagtagtgttggacgctgacaccatcaaccacccagcacagctg
gccaagacctcgctggcccccatcatcgtctttgtcaaagtgtcctcaccaaaggtactc
cagcgtctcattcgctcccgggggaagtcacagatgaagcacctgaccgtacagatgatg
gcatatgataagctggttcagtgcccaccggagtcatttgatgtgattctggatgagaac
cagctggaggatgcctgtgagcacctggctgagtacctggaggtttactggcgggccacg
caccacccagcccctggccccggacttctgggtcctcccagtgccatccccggacttcag
aaccagcagctgctgggggagcgtggcgaggagcactccccccttgagcgggacagcttg
atgccctctgatgaggccagcgagagctcccgccaagcctggacaggatcttcacagcgt
agctcccgccacctggaggaggactatgcagatgcctaccaggacctgtaccagcctcac
cgccaacacacctcggggctgcctagtgctaacgggcatgacccccaagaccggcttcta
gcccaggactcagagcacaaccacagtgaccggaactggcagcgcaaccggccttggccc
aaggatagctactga

DBGET integrated database retrieval system