KEGG   Homo sapiens (human): 784Help
Entry
784               CDS       T01001                                 

Gene name
CACNB3, CAB3, CACNLB3
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit beta 3
  KO
K04864  voltage-dependent calcium channel beta-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    784 (CACNB3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    784 (CACNB3)
  Circulatory system
   04260 Cardiac muscle contraction
    784 (CACNB3)
   04261 Adrenergic signaling in cardiomyocytes
    784 (CACNB3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    784 (CACNB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    784 (CACNB3)
   05414 Dilated cardiomyopathy (DCM)
    784 (CACNB3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN beta
   784 (CACNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1
Motif
Other DBs
NCBI-GeneID: 784
NCBI-ProteinID: NP_000716
OMIM: 601958
HGNC: 1403
Ensembl: ENSG00000167535
Vega: OTTHUMG00000170398
Pharos: P54284(Tbio)
UniProt: P54284
Position
12q13.12
AA seq 484 aa AA seqDB search
MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPV
AFAVRTNVSYCGVLDEECPVQGSGVNFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPS
PQRLESIRLKQEQKARRSGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPV
VLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIER
SSARSSIAEVQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVL
QRLIRSRGKSQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRAT
HHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQR
SSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWP
KDSY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacgactcctacgtgcccgggtttgaggactcggaggcgggttcagccgactcc
tacaccagccgcccatctctggactcagacgtctccctggaggaggaccgggagagtgcc
cggcgtgaagtagagagccaggctcagcagcagctcgaaagggccaagcacaaacctgtg
gcatttgcggtgaggaccaatgtcagctactgtggcgtactggatgaggagtgcccagtc
cagggctctggagtcaactttgaggccaaagattttctgcacattaaagagaagtacagc
aatgactggtggatcgggcggctagtgaaagagggcggggacatcgccttcatccccagc
ccccagcgcctggagagcatccggctcaaacaggagcagaaggccaggagatctgggaac
ccttccagcctgagtgacattggcaaccgacgctcccctccgccatctctagccaagcag
aagcaaaagcaggcggaacatgttcccccatatgacgtggtgccctccatgcggcctgtg
gtgctggtgggaccctctctgaaaggttatgaggtcacagacatgatgcagaaggctctc
ttcgacttcctcaaacacagatttgatggcaggatctccatcacccgagtcacagccgac
ctctccctggcaaagcgatctgtgctcaacaatccgggcaagaggaccatcattgagcgc
tcctctgcccgctccagcattgcggaagtgcagagtgagatcgagcgcatatttgagctg
gccaaatccctgcagctagtagtgttggacgctgacaccatcaaccacccagcacagctg
gccaagacctcgctggcccccatcatcgtctttgtcaaagtgtcctcaccaaaggtactc
cagcgtctcattcgctcccgggggaagtcacagatgaagcacctgaccgtacagatgatg
gcatatgataagctggttcagtgcccaccggagtcatttgatgtgattctggatgagaac
cagctggaggatgcctgtgagcacctggctgagtacctggaggtttactggcgggccacg
caccacccagcccctggccccggacttctgggtcctcccagtgccatccccggacttcag
aaccagcagctgctgggggagcgtggcgaggagcactccccccttgagcgggacagcttg
atgccctctgatgaggccagcgagagctcccgccaagcctggacaggatcttcacagcgt
agctcccgccacctggaggaggactatgcagatgcctaccaggacctgtaccagcctcac
cgccaacacacctcggggctgcctagtgctaacgggcatgacccccaagaccggcttcta
gcccaggactcagagcacaaccacagtgaccggaactggcagcgcaaccggccttggccc
aaggatagctactga

DBGET integrated database retrieval system