KEGG   Homo sapiens (human): 7850Help
Entry
7850              CDS       T01001                                 

Gene name
IL1R2, CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Definition
interleukin 1 receptor, type II
Orthology
K04387  
interleukin 1 receptor type II
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Amoebiasis
HTLV-I infection
Transcriptional misregulation in cancer
Drug target
Anakinra: 
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q12
AA seq 296 aa AA seqDB search
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcttgtacgtgttggtaatgggagtttctgccttcacccttcagcctgcggca
cacacaggggctgccagaagctgccggtttcgtgggaggcattacaagcgggagttcagg
ctggaaggggagcctgtagccctgaggtgcccccaggtgccctactggttgtgggcctct
gtcagcccccgcatcaacctgacatggcataaaaatgactctgctaggacggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagccttgcag
gaggactctggcacctacgtctgcactactagaaatgcttcttactgtgacaaaatgtcc
attgagctcagagtttttgagaatacagatgctttcctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtatgccctgacctgagtgaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcttttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactcgtacacgatgtggccctggaa
gatgctggctattaccgctgtgtcctgacatttgcccatgaaggccagcaatacaacatc
actaggagtattgagctacgcatcaagaaaaaaaaagaagagaccattcctgtgatcatt
tcccccctcaagaccatatcagcttctctggggtcaagactgacaatcccgtgtaaggtg
tttctgggaaccggcacacccttaaccaccatgctgtggtggacggccaatgacacccac
atagagagcgcctacccgggaggccgcgtgaccgaggggccacgccagtaa

DBGET integrated database retrieval system