KEGG   Homo sapiens (human): 7850Help
Entry
7850              CDS       T01001                                 

Gene name
IL1R2, CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
hsa05166  HTLV-I infection
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
N00128  TMPRSS2-ERG fusion to transcriptional activation
Drug target
Anakinra: D02934
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7850 (IL1R2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    7850 (IL1R2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    7850 (IL1R2)
   05215 Prostate cancer
    7850 (IL1R2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7850 (IL1R2)
  Infectious diseases
   05166 HTLV-I infection
    7850 (IL1R2)
   05146 Amoebiasis
    7850 (IL1R2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   7850 (IL1R2)
CD molecules [BR:hsa04090]
 Proteins
  7850 (IL1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 I-set Ig_2 V-set Ig_5 Izumo-Ig stn_TNFRSF12A
Motif
Other DBs
NCBI-GeneID: 7850
NCBI-ProteinID: NP_004624
OMIM: 147811
HGNC: 5994
Ensembl: ENSG00000115590
Vega: OTTHUMG00000130695
Pharos: P27930(Tbio)
UniProt: P27930
Structure
PDB: 

Jmol
Position
2q11.2
AA seq 398 aa AA seqDB search
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcttgtacgtgttggtaatgggagtttctgccttcacccttcagcctgcggca
cacacaggggctgccagaagctgccggtttcgtgggaggcattacaagcgggagttcagg
ctggaaggggagcctgtagccctgaggtgcccccaggtgccctactggttgtgggcctct
gtcagcccccgcatcaacctgacatggcataaaaatgactctgctaggacggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagccttgcag
gaggactctggcacctacgtctgcactactagaaatgcttcttactgtgacaaaatgtcc
attgagctcagagtttttgagaatacagatgctttcctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtatgccctgacctgagtgaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcttttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactcgtacacgatgtggccctggaa
gatgctggctattaccgctgtgtcctgacatttgcccatgaaggccagcaatacaacatc
actaggagtattgagctacgcatcaagaaaaaaaaagaagagaccattcctgtgatcatt
tcccccctcaagaccatatcagcttctctggggtcaagactgacaatcccgtgtaaggtg
tttctgggaaccggcacacccttaaccaccatgctgtggtggacggccaatgacacccac
atagagagcgcctacccgggaggccgcgtgaccgaggggccacgccaggaatattcagaa
aataatgagaactacattgaagtgccattgatttttgatcctgtcacaagagaggatttg
cacatggattttaaatgtgttgtccataataccctgagttttcagacactacgcaccaca
gtcaaggaagcctcctccacgttctcctggggcattgtgctggccccactttcactggcc
ttcttggttttggggggaatatggatgcacagacggtgcaaacacagaactggaaaagca
gatggtctgactgtgctatggcctcatcatcaagactttcaatcctatcccaagtga

DBGET integrated database retrieval system