KEGG   Homo sapiens (human): 7855Help
Entry
7855              CDS       T01001                                 

Gene name
FZD5, C2orf31, HFZ5
Definition
(RefSeq) frizzled class receptor 5
  KO
K02375  
frizzled 5/8
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7855 (FZD5)
   04390 Hippo signaling pathway
    7855 (FZD5)
   04150 mTOR signaling pathway
    7855 (FZD5)
 Cellular Processes
  Cellular community
   04550 Signaling pathways regulating pluripotency of stem cells
    7855 (FZD5)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7855 (FZD5)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7855 (FZD5)
   05205 Proteoglycans in cancer
    7855 (FZD5)
   05217 Basal cell carcinoma
    7855 (FZD5)
   05224 Breast cancer
    7855 (FZD5)
  Infectious diseases
   05166 HTLV-I infection
    7855 (FZD5)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    7855 (FZD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33.3
AA seq 585 aa AA seqDB search
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGG
ECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSHV
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcctgacccatccgcgccgccctcgctgttgctgctgctcctagcgcagctg
gtgggccgggcggccgccgcgtccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccaatgctcgccg
gacctgcgcttcttcctatgctctatgtacacgcccatctgtctgcccgactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctgatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctctgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcctttcccagccaagcccacccttccaggcccgccaggggcgccggcctcggggggc
gaatgccccgctgggggcccgttcgtgtgcaagtgtcgcgagcccttcgtgcccattctg
aaggagtcacacccgctctacaacaaggtgcggacgggccaggtgcccaactgcgcggta
ccctgctaccagccgtccttcagtgccgacgagcgcacgttcgccaccttctggataggc
ctgtggtcggtgctgtgcttcatctccacgtccaccacagtggccaccttcctcatcgac
atggaacgcttccgctatcctgagcgccccatcatcttcctgtcagcctgctacctgtgc
gtgtcgctgggcttcctggtgcgtctggtcgtgggccatgccagcgtggcctgcagccgc
gagcacaaccacatccactacgagaccacgggccctgcactgtgcaccatcgtcttcctc
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcctggccgccggcatgaagtggggcaacgaggccatcgcgggctacgcgcagtacttc
cacctggctgcgtggctcatccccagcgtcaagtccatcacggcactggcgctgagctcc
gtggacggggacccagtggccggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcacgctcttcctgctg
gcgggcttcgtgtcgctcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacacggtcccc
gccagcattgtggtggcctgctacctgtacgagcagcactaccgcgagagctgggaggcg
gcgctcacctgcgcctgcccgggccacgacaccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggcgtctgg
atctggtcgggcaagacggtggagtcgtggcggcgtttcaccagccgctgctgctgccgc
ccgcggcgcggccacaagagcgggggcgccatggccgcaggggactaccccgaggcgagc
gccgcgctcacaggcaggaccgggccgccgggccccgccgccacctaccacaagcaggtg
tccctgtcgcacgtgtag

DBGET integrated database retrieval system