KEGG   Homo sapiens (human): 786Help
Entry
786               CDS       T01001                                 

Gene name
CACNG1, CACNLG
Definition
calcium channel, voltage-dependent, gamma subunit 1
Orthology
K04866  
voltage-dependent calcium channel gamma-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    786 (CACNG1)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    786 (CACNG1)
  Circulatory system
   04260 Cardiac muscle contraction
    786 (CACNG1)
   04261 Adrenergic signaling in cardiomyocytes
    786 (CACNG1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    786 (CACNG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    786 (CACNG1)
   05414 Dilated cardiomyopathy (DCM)
    786 (CACNG1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   786 (CACNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q24
AA seq 222 aa AA seqDB search
MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKR
IPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIIL
GSLCVLLSLGKKRDYLLRPASMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSW
SFACACAAFILLFLGGLALLLFSLPRMPRNPWESCMDAEPEH
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaccaaaatgctgaaggtccgcgtgaccctcttctgcatcctggcaggcatc
gtgctggccatgacagccgtggtaaccgaccactgggctgtgctgagcccccacatggag
caccacaacactacctgcgaggcggcccacttcggcctctggcggatttgtaccaagcgc
atccccatggacgacagcaagacctgcgggcccatcaccctgcccggggagaagaactgt
tcctacttcaggcattttaaccccggcgagagctcggagatcttcgaattcaccactcag
aaggagtacagcatctcggcagccgccatcgccatcttcagccttggcttcatcatcctg
ggcagcctctgtgtcctcctgtccctcgggaagaagagggactatctgctgcgacccgcg
tccatgttctatgcctttgcaggtctctgcatcctcgtctcggtggaggtcatgcggcag
tcggtgaagcgcatgattgacagtgaggacaccgtctggatcgagtactattactcctgg
tcctttgcctgcgcctgtgccgccttcatcctcctctttctcggcggtctcgccctcctg
ctgttctccctgcctcgaatgccccggaacccatgggagtcctgcatggatgctgagccc
gagcactaa

DBGET integrated database retrieval system