KEGG   Homo sapiens (human): 7862Help
Entry
7862              CDS       T01001                                 

Gene name
BRPF1, BR140
Definition
(RefSeq) bromodomain and PHD finger containing 1
  KO
K11348  
bromodomain and PHD finger-containing protein 1
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    MOZ/MORF complex
     7862 (BRPF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p26-p25
AA seq 1214 aa AA seqDB search
MGVDFDVKTFCHNLRATKPPYECPVETCRKVYKSYSGIEYHLYHYDHDNPPPPQQTPLRK
HKKKGRQSRPANKQSPSPSEVSQSPGREVMSYAQAQRMVEVDLHGRVHRISIFDNLDVVS
EDEEAPEEAPENGSNKENTETPAATPKSGKHKNKEKRKDSNHHHHHNVSASTTPKLPEVV
YRELEQDTPDAPPRPTSYYRYIEKSAEELDEEVEYDMDEEDYIWLDIMNERRKTEGVSPI
PQEIFEYLMDRLEKESYFESHNKGDPNALVDEDAVCCICNDGECQNSNVILFCDMCNLAV
HQECYGVPYIPEGQWLCRRCLQSPSRAVDCALCPNKGGAFKQTDDGRWAHVVCALWIPEV
CFANTVFLEPIDSIEHIPPARWKLTCYICKQRGSGACIQCHKANCYTAFHVTCAQQAGLY
MKMEPVRETGANGTSFSVRKTAYCDIHTPPGSARRLPALSHSEGEEDEDEEEDEGKGWSS
EKVKKAKAKSRIKMKKARKILAEKRAAAPVVSVPCIPPHRLSKITNRLTIQRKSQFMQRL
HSYWTLKRQSRNGVPLLRRLQTHLQSQRNCDQVGRDSEDKNWALKEQLKSWQRLRHDLER
ARLLVELIRKREKLKRETIKVQQIAMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLS
EVPDYLDHIKKPMDFFTMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVR
LREQGGAVLRQARRQAEKMGIDFETGMHIPHSLAGDEATHHTEDAAEEERLVLLENQKHL
PVEEQLKLLLERLDEVNASKQSVGRSRRAKMIKKEMTALRRKLAHQRETGRDGPERHGPS
SRGSLTPHPAACDKDGQTDSAAEESSSQETSKGLGPNMSSTPAHEVGRRTSVLFSKKNPK
TAGPPKRPGRPPKNRESQMTPSHGGSPVGPPQLPIMSSLRQRKRGRSPRPSSSSDSDSDK
STEDPPMDLPANGFSGGNQPVKKSFLVYRNDCSLPRSSSDSESSSSSSSSAASDRTSTTP
SKQGRGKPSFSRGTFPEDSSEDTSGTENEAYSVGTGRGVGHSMVRKSLGRGAGWLSEDED
SPLDALDLVWAKCRGYPSYPALIIDPKMPREGMFHHGVPIPVPPLEVLKLGEQMTQEARE
HLYLVLFFDNKRTWQWLPRTKLVPLGVNQDLDKEKMLEGRKSNIRKSVQIAYHRALQHRS
KVQGEQSSETSDSD
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atgggggtggactttgatgtgaagactttctgccacaacttgcgggcgactaagccacca
tacgagtgcccggtggagacctgccgaaaggtctacaagagttacagtggtattgagtac
cacctgtaccactatgaccacgacaacccaccacccccacaacaaactccactccgcaag
cacaagaaaaaggggcgccagtcacgcccagccaacaagcagtcacccagcccctcagag
gtctcacagtcaccaggccgtgaggtgatgagctatgcacaggcccagcgcatggtggag
gtggacttgcatggccgcgtccaccgcatcagcatctttgacaacctggatgtggtgtca
gaggatgaggaagcccccgaggaggcccctgagaatggcagcaacaaggagaacactgag
acaccagctgctactcccaagtcaggcaaacataagaacaaggagaagcgcaaggactcc
aaccatcaccaccaccacaatgtttctgcgagcaccactcccaagctgccagaggtggtc
tatcgggagctggaacaggacacccctgatgccccaccccggccaacttcctattaccgg
tacatcgagaagtctgcagaggagctggacgaggaagtagagtatgacatggacgaggag
gactacatctggctggatatcatgaatgagcgtcggaagacagagggtgtaagtcccatc
ccgcaggagatctttgagtacctaatggaccgactggagaaggagtcgtactttgagagt
cataataaaggcgaccctaatgcgctagtggacgaggatgctgtttgctgtatctgcaat
gatggtgagtgccagaacagcaatgtcatcctcttctgtgacatgtgcaacctggccgtg
caccaggagtgctacggtgtcccctatatccctgagggccagtggctgtgccgccgttgc
ctgcagtcaccctctcgtgctgtggattgtgccctgtgccccaacaagggcggtgccttc
aagcagacagatgacgggcgctgggcccatgtggtgtgtgccttgtggatccctgaggtc
tgcttcgccaacacggtcttcctagagcctattgacagcattgagcacatcccaccagct
cgctggaagctcacctgctacatttgcaaacaacggggctcaggggcctgcatccagtgc
cacaaggccaactgttacacagctttccatgtgacatgcgcccagcaggctggcctttac
atgaagatggagcctgtgcgggagacaggcgccaacggcacctctttcagtgtccgcaag
acagcctactgcgacatccacacgcctccaggttcagcacgccgactgcctgccctgtcc
cacagcgagggtgaggaggatgaagatgaggaggaggatgagggtaagggctggagctca
gagaaagtcaagaaggccaaggccaagtcccggatcaaaatgaagaaggcacggaagatc
ctggcagagaagcgggcagcagcacctgtggtgtcagtgccctgcatcccaccacacagg
cttagtaaaatcaccaaccgcctgaccatccaaaggaagagccagttcatgcagaggctg
cacagctactggacactgaagcggcagtcacggaatggggtcccattgctacgtcgcctg
cagacacacctgcaatctcagaggaactgtgaccaagttgggagagattctgaggataag
aactgggcccttaaagaacagctcaagtcctggcagcggctccggcatgacttggagcga
gctcggctgctcgtggaattgatccgcaagcgggaaaaactcaaaagggagacgatcaag
gttcagcagattgccatggagatgcagctgactcctttcctcatcctccttcgcaaaacc
ttggagcagctccaagagaaggacacaggcaacatcttcagcgagccggtccctctgtct
gaggtacctgactacctagaccacatcaaaaagcccatggactttttcaccatgaagcag
aacttggaggcttaccgctacctgaattttgatgattttgaggaggacttcaacctcatc
gtcagcaactgcctcaagtataacgccaaggacaccatcttctaccgggcagcagtgcgg
cttcgtgagcagggtggtgctgtgctccgccaggcccggcgccaggcagaaaaaatgggc
attgactttgagacgggcatgcatatcccccacagcctggctggagatgaggccacacac
cacactgaagatgcagccgaggaagagcggctggtcttgctggagaaccagaagcacctg
ccagtggaagaacagctaaagctgcttctggagcggctggacgaagtgaatgccagcaag
cagagtgtgggccgctcacggcgtgcaaagatgatcaagaaagagatgacggcactgcgg
cggaagcttgcccatcagcgagagacgggacgtgatggccctgagcggcatggcccctcg
agccggggtagtctgacaccccacccggcagcctgtgacaaggatgggcagacagatagt
gcggcagaggagagcagcagccaggagacaagcaaaggcctgggtcccaacatgtcctca
acccccgcacatgaggtgggcaggagaacctcagttctgttctccaaaaagaacccgaag
acagctggaccgcccaagaggccgggccggccccccaaaaaccgggagagccagatgacc
cccagccacggaggcagtcctgtggggcccccccagctccccatcatgagttccctgcgt
cagcgcaagcggggtaggagcccccggcccagttcgagctcagacagcgacagtgataag
tccacagaagaccccccaatggacttaccagccaatggcttcagcggtggaaaccaacca
gtgaagaagagtttcttggtataccgtaatgactgcagccttccccggagcagctcagac
tctgagtccagcagcagtagcagtagcagcgctgcttcagaccggaccagcacaacgccc
tcaaaacaaggccggggcaaaccctccttctctcggggcactttcccagaggacagcagt
gaggatacctcaggcactgagaatgaggcctactccgtgggcactggccgcggcgtgggc
cacagcatggtaaggaagagtctgggccggggagctggctggctgtcagaggatgaggac
tccccgctggatgctctggacctcgtgtgggccaaatgccgaggctatccatcataccca
gctctgatcattgatccaaagatgccccgagaaggtatgttccaccatggggttcccatc
cctgtgcccccactggaggtgctgaaacttggggagcagatgacccaggaagcccgagag
catctctacctcgtcctcttctttgacaacaaacgaacctggcagtggctgcccaggacc
aagctggttcctctgggtgtgaaccaggacctagacaaggagaagatgctggagggccgc
aagtccaacatccgcaagtcagtacagatcgcctaccacagggctctgcagcaccgcagc
aaggtgcaaggcgagcagagcagtgagaccagcgatagtgattga

DBGET integrated database retrieval system