KEGG   Homo sapiens (human): 7867Help
Entry
7867              CDS       T01001                                 

Gene name
MAPKAPK3, 3PK, MAPKAP-K3, MAPKAP3, MAPKAPK-3, MK-3
Definition
mitogen-activated protein kinase-activated protein kinase 3 (EC:2.7.11.1)
Orthology
K04444  
mitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7867 (MAPKAPK3)
   04370 VEGF signaling pathway
    7867 (MAPKAPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7867 (MAPKAPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [OT]
   7867 (MAPKAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.3
AA seq 382 aa AA seqDB search
MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE
CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMEC
MEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKD
AVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFP
PFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMN
HPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR
LLNKRRKKQAGSSSASQGCNNQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgaaacagcagaggagcaggggggccctgtgcccccgccagttgcacccggc
ggacccggcttgggcggtgctccgggggggcggcgggagcccaagaagtacgcagtgacc
gacgactaccagttgtccaagcaggtgctgggcctgggtgtgaacggcaaagtgctggag
tgcttccatcggcgcactggacagaagtgtgccctgaagctcctgtatgacagccccaag
gcccggcaggaggtagaccatcactggcaggcttctggcggcccccatattgtctgcatc
ctggatgtgtatgagaacatgcaccatggcaagcgctgtctcctcatcatcatggaatgc
atggaaggtggtgagttgttcagcaggattcaggagcgtggcgaccaggctttcactgag
agagaagctgcagagataatgcgggatattggcactgccatccagtttctgcacagccat
aacattgcccaccgagatgtcaagcctgaaaacctactctacacatctaaggagaaagac
gcagtgcttaagctcaccgattttggctttgctaaggagaccacccaaaatgccctgcag
acaccctgctatactccctattatgtggcccctgaggtcctgggtccagagaagtatgac
aagtcatgtgacatgtggtccctgggtgtcatcatgtacatcctcctttgtggcttccca
cccttctactccaacacgggccaggccatctccccggggatgaagaggaggattcgcctg
ggccagtacggcttccccaatcctgagtggtcagaagtctctgaggatgccaagcagctg
atccgcctcctgttgaagacagaccccacagagaggctgaccatcactcagttcatgaac
cacccctggatcaaccaatcgatggtagtgccacagaccccactccacacggcccgagtg
ctgcaggaggacaaagaccactgggacgaagtcaaggaggagatgaccagtgccttggcc
actatgcgggtagactacgaccaggtgaagatcaaggacctgaagacctctaacaaccgg
ctcctcaacaagaggagaaaaaagcaggcaggcagctcctctgcctcacagggctgcaac
aaccagtag

DBGET integrated database retrieval system