KEGG   Homo sapiens (human): 7867Help
Entry
7867              CDS       T01001                                 

Gene name
MAPKAPK3, 3PK, MAPKAP-K3, MAPKAP3, MAPKAPK-3, MDPT3, MK-3
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 3
  KO
K04444  
mitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    7867 (MAPKAPK3)
   04370 VEGF signaling pathway
    7867 (MAPKAPK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7867 (MAPKAPK3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [OT]
   7867 (MAPKAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q16644(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3p21.2
AA seq 382 aa AA seqDB search
MDGETAEEQGGPVPPPVAPGGPGLGGAPGGRREPKKYAVTDDYQLSKQVLGLGVNGKVLE
CFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVCILDVYENMHHGKRCLLIIMEC
MEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSHNIAHRDVKPENLLYTSKEKD
AVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGFP
PFYSNTGQAISPGMKRRIRLGQYGFPNPEWSEVSEDAKQLIRLLLKTDPTERLTITQFMN
HPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNR
LLNKRRKKQAGSSSASQGCNNQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgaaacagcagaggagcaggggggccctgtgcccccgccagttgcacccggc
ggacccggcttgggcggtgctccgggggggcggcgggagcccaagaagtacgcagtgacc
gacgactaccagttgtccaagcaggtgctgggcctgggtgtgaacggcaaagtgctggag
tgcttccatcggcgcactggacagaagtgtgccctgaagctcctgtatgacagccccaag
gcccggcaggaggtagaccatcactggcaggcttctggcggcccccatattgtctgcatc
ctggatgtgtatgagaacatgcaccatggcaagcgctgtctcctcatcatcatggaatgc
atggaaggtggtgagttgttcagcaggattcaggagcgtggcgaccaggctttcactgag
agagaagctgcagagataatgcgggatattggcactgccatccagtttctgcacagccat
aacattgcccaccgagatgtcaagcctgaaaacctactctacacatctaaggagaaagac
gcagtgcttaagctcaccgattttggctttgctaaggagaccacccaaaatgccctgcag
acaccctgctatactccctattatgtggcccctgaggtcctgggtccagagaagtatgac
aagtcatgtgacatgtggtccctgggtgtcatcatgtacatcctcctttgtggcttccca
cccttctactccaacacgggccaggccatctccccggggatgaagaggaggattcgcctg
ggccagtacggcttccccaatcctgagtggtcagaagtctctgaggatgccaagcagctg
atccgcctcctgttgaagacagaccccacagagaggctgaccatcactcagttcatgaac
cacccctggatcaaccaatcgatggtagtgccacagaccccactccacacggcccgagtg
ctgcaggaggacaaagaccactgggacgaagtcaaggaggagatgaccagtgccttggcc
actatgcgggtagactacgaccaggtgaagatcaaggacctgaagacctctaacaaccgg
ctcctcaacaagaggagaaaaaagcaggcaggcagctcctctgcctcacagggctgcaac
aaccagtag

KEGG   Homo sapiens (human): 9261Help
Entry
9261              CDS       T01001                                 

Gene name
MAPKAPK2, MAPKAP-K2, MK-2, MK2
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 2
  KO
K04443  
mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Cellular senescence
VEGF signaling pathway
Neurotrophin signaling pathway
Kaposi's sarcoma-associated herpesvirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    9261 (MAPKAPK2)
   04370 VEGF signaling pathway
    9261 (MAPKAPK2)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    9261 (MAPKAPK2)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    9261 (MAPKAPK2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    9261 (MAPKAPK2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    9261 (MAPKAPK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     9261 (MAPKAPK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  MAPKAPK family [OT]
   9261 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49137(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
1q32.1
AA seq 400 aa AA seqDB search
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaactcccagggccagagcccgccggtgccgttccccgccccggccccgccg
ccgcagccccccacccctgccctgccgcaccccccggcgcagccgccgccgccgcccccg
cagcagttcccgcagttccacgtcaagtccggcctgcagatcaagaagaacgccatcatc
gatgactacaaggtcaccagccaggtcctggggctgggcatcaacggcaaagttttgcag
atcttcaacaagaggacccaggagaaattcgccctcaaaatgcttcaggactgccccaag
gcccgcagggaggtggagctgcactggcgggcctcccagtgcccgcacatcgtacggatc
gtggatgtgtacgagaatctgtacgcagggaggaagtgcctgctgattgtcatggaatgt
ttggacggtggagaactctttagccgaatccaggatcgaggagaccaggcattcacagaa
agagaagcatccgaaatcatgaagagcatcggtgaggccatccagtatctgcattcaatc
aacattgcccatcgggatgtcaagcctgagaatctcttatacacctccaaaaggcccaac
gccatcctgaaactcactgactttggctttgccaaggaaaccaccagccacaactctttg
accactccttgttatacaccgtactatgtggctccagaagtgctgggtccagagaagtat
gacaagtcctgtgacatgtggtccctgggtgtcatcatgtacatcctgctgtgtgggtat
ccccccttctactccaaccacggccttgccatctctccgggcatgaagactcgcatccga
atgggccagtatgaatttcccaacccagaatggtcagaagtatcagaggaagtgaagatg
ctcattcggaatctgctgaaaacagagcccacccagagaatgaccatcaccgagtttatg
aaccacccttggatcatgcaatcaacaaaggtccctcaaaccccactgcacaccagccgg
gtcctgaaggaggacaaggagcggtgggaggatgtcaaggaggagatgaccagtgccttg
gccacaatgcgcgttgactacgagcagatcaagataaaaaagattgaagatgcatccaac
cctctgctgctgaagaggcggaagaaagctcgggccctggaggctgcggctctggcccac
tga

DBGET integrated database retrieval system