KEGG   Homo sapiens (human): 7874Help
Entry
7874              CDS       T01001                                 

Gene name
USP7, HAUSP, TEF1
Definition
(RefSeq) ubiquitin specific peptidase 7
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    7874 (USP7)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7874 (USP7)
  Infectious diseases
   05168 Herpes simplex infection
    7874 (USP7)
   05169 Epstein-Barr virus infection
    7874 (USP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     7874 (USP7)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   7874 (USP7)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    7874 (USP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 1102 aa AA seqDB search
MNHQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHNTAEEDME
DDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNI
FESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
SLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTI
FLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVM
CDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSEL
PTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLN
SQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREV
MKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLD
HFNKAPKRSRYTYLEKAIKIHN
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccagcagcagcagcagcagcagaaagcgggcgagcagcagttgagcgagccc
gaggacatggagatggaagcgggagatacagatgacccaccaagaattactcagaaccct
gtgatcaatgggaatgtggccctgagtgatggacacaacaccgcggaggaggacatggag
gatgacaccagttggcgctccgaggcaacctttcagttcactgtggagcgcttcagcaga
ctgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagattatg
gtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattctttctccag
tgcaatgctgaatctgattccacgtcatggtcttgccatgcacaagcagtgctgaagata
ataaattacagagatgatgaaaagtcgttcagtcgtcgtattagtcatttgttcttccat
aaagaaaatgattggggattttccaattttatggcctggagtgaagtgaccgatcctgag
aaaggatttatagatgatgacaaagttacctttgaagtctttgtacaggcggatgctccc
catggagttgcgtgggattcaaagaagcacacaggctacgtcggcttaaagaatcaggga
gcgacttgttacatgaacagcctgctacagacgttatttttcacgaatcagctacgaaag
gctgtgtacatgatgccaaccgagggggatgattcgtctaaaagcgtccctttagcatta
caaagagtgttctatgaattacagcatagtgataaacctgtaggaacaaaaaagttaaca
aagtcatttgggtgggaaactttagatagcttcatgcaacatgatgttcaggagctttgt
cgagtgttgctcgataatgtggaaaataagatgaaaggcacctgtgtagagggcaccata
cccaaattattccgcggcaaaatggtgtcctatatccagtgtaaagaagtagactatcgg
tctgatagaagagaagattattatgatatccagctaagtatcaaaggaaagaaaaatata
tttgaatcatttgtggattatgtggcagtagaacagctcgatggggacaataaatacgac
gctggggaacatggcttacaggaagcagagaaaggtgtgaaattcctaacattgccacca
gtgttacatctacaactgatgagatttatgtatgaccctcagacggaccaaaatatcaag
atcaatgataggtttgaattcccagagcagttaccacttgatgaatttttgcaaaaaaca
gatcctaaggaccctgcaaattatattcttcatgcagtcctggttcatagtggagataat
catggtggacattatgtggtttatctaaaccccaaaggggatggcaaatggtgtaaattt
gatgacgacgtggtgtcaaggtgtactaaagaggaagcaattgagcacaattatgggggt
cacgatgacgacctgtctgttcgacactgcactaatgcttacatgttagtctacatcagg
gaatcaaaactgagtgaagttttacaggcggtcaccgaccatgatattcctcagcagttg
gtggagcgattacaagaagagaaaaggatcgaggctcagaagcggaaggagcggcaggaa
gcccatctctatatgcaagtgcagatagtcgcagaggaccagttttgtggccaccaaggg
aatgacatgtacgatgaagaaaaagtgaaatacactgtgttcaaagtattgaagaactcc
tcgcttgctgagtttgttcagagcctctctcagaccatgggatttccacaagatcaaatt
cgattgtggcccatgcaagcaaggagtaatggaacaaaacgaccagcaatgttagataat
gaagccgacggcaataaaacaatgattgagctcagtgataatgaaaacccttggacaata
ttcctggaaacagttgatcccgagctggctgctagtggagcgaccttacccaagtttgat
aaagatcatgatgtaatgttatttttgaagatgtatgatcccaaaacgcggagcttgaat
tactgtgggcatatctacacaccaatatcctgtaaaatacgtgacttgctcccagttatg
tgtgacagagcaggatttattcaagatactagccttatcctctatgaggaagttaaaccg
aatttaacagagagaattcaggactatgacgtgtctcttgataaagcccttgatgaacta
atggatggtgacatcatagtatttcagaaggatgaccctgaaaatgataacagtgaatta
cccaccgcaaaggagtatttccgagatctctaccaccgcgttgatgtcattttctgtgat
aaaacaatccctaatgatcctggatttgtggttacgttatcaaatagaatgaattatttt
caggttgcaaagacagttgcacagaggctcaacacagatccaatgttgctgcagtttttc
aagtctcaaggttatagggatggcccaggtaatcctcttagacataattatgaaggtact
ttaagagatcttctacagttcttcaagcctagacaacctaagaaactttactatcagcag
cttaagatgaaaatcacagactttgagaacaggcgaagttttaaatgtatatggttaaac
agccaatttagggaagaggaaataacactatatccagacaagcatgggtgtgtccgggac
ctgttagaagaatgtaaaaaggccgtggagcttggggagaaagcatcagggaaacttagg
ctgctagaaattgtaagctacaaaatcattggtgttcatcaagaagatgaactattagaa
tgtttatctcctgcaacgagccggacgtttcgaatagaggaaatccctttggaccaggtg
gacatagacaaagagaatgagatgcttgtcacagtggcgcatttccacaaagaggtcttc
ggaacgttcggaatcccgtttttgctgaggatacaccagggcgagcattttcgagaagtg
atgaagcgaatccagagcctgctggacatccaggagaaggagtttgagaagtttaaattt
gcaattgtaatgatgggccgacaccagtacataaatgaagacgagtatgaagtaaatttg
aaagactttgagccacagcccggtaatatgtctcatcctcggccttggctagggctcgac
cacttcaacaaagccccaaagaggagtcgctacacttaccttgaaaaggccattaaaatc
cataactga

DBGET integrated database retrieval system