KEGG   Homo sapiens (human): 7881Help
Entry
7881              CDS       T01001                                 

Gene name
KCNAB1, AKR6A3, KCNA1B, KV-BETA-1, Kvb1.3, hKvBeta3, hKvb3
Definition
(RefSeq) potassium voltage-gated channel subfamily A member regulatory beta subunit 1
  KO
K04882  
potassium voltage-gated channel Shaker-related subfamily A, beta member 1
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   7881 (KCNAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.1
AA seq 419 aa AA seqDB search
MLAARTGAAGSQISEENTKLRRQSGFSVAGKDKSPKKASENAKDSSLSPSGESQLRARQL
ALLREVEMNWYLKLCDLSSEHTTVCTTGMPHRNLGKSGLRVSCLGLGTWVTFGGQISDEV
AERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETE
RGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTS
RWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLAC
GIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV
AWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgctggcagcccggacaggggcagcggggagtcagatctcagaggagaacaccaagtta
aggagacagtctgggttttctgtagcagggaaagacaaatctcccaagaaagcctcagaa
aacgctaaagacagcagccttagtccctcaggggaaagccagctcagggcgcgtcaactg
gctctgctgcgcgaagtggagatgaactggtacctaaagctctgcgacctgtccagcgag
cacaccaccgtctgcaccacaggcatgccgcacaggaatcttggaaaatcaggactcaga
gtttcttgcttgggtcttggaacatgggtgacatttggaggtcaaatttcagatgaggtt
gctgaacggctgatgaccatcgcctatgaaagtggtgttaacctctttgatactgccgaa
gtctatgctgctggaaaggctgaagtgattctggggagcatcatcaagaagaaaggctgg
aggaggtccagtctggtcataacaaccaaactctactggggtggaaaagctgaaacagaa
agagggctgtcaagaaagcatattattgaaggattgaagggctccctccagaggctgcag
ctcgagtatgtggatgtggtctttgcaaatcgaccggacagtaacactcccatggaagaa
attgtccgagccatgacacatgtgataaaccaaggcatggcgatgtactggggcacctcg
agatggagtgctatggagatcatggaagcctattctgtagcaagacagttcaatatgatc
ccaccggtctgtgaacaagctgagtaccatcttttccagagagagaaagtggaggtccag
ctgccagagctctaccacaaaataggtgttggcgcaatgacatggtctccacttgcctgt
ggaatcatctcaggaaaatacggaaacggggtgcctgaaagttccagggcttcactgaag
tgctaccagtggttgaaagaaagaattgtaagtgaagaagggagaaaacagcaaaacaag
ctaaaagacctttccccaattgcggagcgtctgggatgcacactacctcagctagctgtt
gcgtggtgcctgagaaatgaaggtgtgagttctgtgctcctgggatcatccactcctgaa
caactcattgaaaaccttggtgccattcaggttctcccaaagatgacatcacatgtggta
aatgagattgataacatactgcgcaacaagccctacagcaagaaggactatagatcataa

DBGET integrated database retrieval system