KEGG   Homo sapiens (human): 79023Help
Entry
79023             CDS       T01001                                 

Gene name
NUP37, p37
Definition
nucleoporin 37kDa
Orthology
K14302  
nuclear pore complex protein Nup37
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    79023 (NUP37)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     79023 (NUP37)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q23.2
AA seq 326 aa AA seqDB search
MKQDASRNAAYTVDCEDYVHVVEFNPFENGDSGNLIAYGGNNYVVIGTCTFQEEEADVEG
IQYKTLRTFHHGVRVDGIAWSPETRLDSLPPVIKFCTSAADMKIRLFTSDLQDKNEYKVL
EGHTDFINGLVFDPKEGQEIASVSDDHTCRIWNLEGVQTAHFVLHSPGMSVCWHPEETFK
LMVAEKNGTIRFYDLLAQQAILSLESEQVPLMSAHWCLKNTFKVGAVAGNDWLIWDITRS
SYPQNKRPVHMDRACLFRWSTISENLFATTGYPGKMASQFQIHHLGHPQPILMGSVAVGS
GLSWHRTLPLCVIGGDHKLLFWVTEV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagatgcctcaagaaatgctgcctacactgtggattgtgaagattatgtgcat
gtggtagaatttaatccctttgagaatggggattcaggaaacctaattgcatatggtggc
aataattatgtggtcattggcacgtgtacgtttcaggaagaagaagcagacgttgaaggc
attcagtataaaacacttcgaacatttcaccatggagtcagggttgatggcatagcttgg
agcccagagactagacttgattcattgcctccagtaatcaaattttgtacttcagctgct
gatatgaaaattagattatttacttcagatcttcaggataaaaatgaatataaggtttta
gagggccataccgatttcattaatggtttggtgtttgatcccaaagaaggccaagaaatt
gcaagtgtgagtgacgatcacacctgcaggatttggaacttggaaggagtgcaaacagct
cattttgttcttcattctcctggcatgagtgtgtgctggcatcctgaggagacttttaag
ctaatggttgcagagaagaatggaacaatccggttttatgatcttttggcccaacaggct
attttatctcttgaatcagaacaagtgccattaatgtcagcacactggtgcttaaaaaac
accttcaaagttggagccgttgcaggaaatgattggttaatttgggatattactcggtcc
agttatcctcaaaataagagacctgttcacatggatcgagcctgcttattcaggtggtcc
acaattagtgaaaatctgtttgcaaccactggttatcctggcaaaatggcaagccagttt
caaattcatcatttaggacaccctcagcccatcctcatgggttctgtagccgttggatct
ggactgtcctggcatcgaactctccctctgtgtgtaattggaggagaccacaagctgttg
ttttgggtgactgaagtataa

DBGET integrated database retrieval system