KEGG   Homo sapiens (human): 79054Help
Entry
79054             CDS       T01001                                 

Gene name
TRPM8, LTRPC6, TRPP8
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 8
  KO
K04983  
transient receptor potential cation channel subfamily M member 8
Organism
hsa  Homo sapiens (human)
Pathway
Inflammatory mediator regulation of TRP channels
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    79054 (TRPM8)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   79054 (TRPM8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.1
AA seq 1104 aa AA seqDB search
MSFRAARLSMRNRRNDTLDSTRTLYSSASRSTDLSYSESDLVNFIQANFKKRECVFFTKD
SKATENVCKCGYAQSQHMEGTQINQSEKWNYKKHTKEFPTDAFGDIQFETLGKKGKYIRL
SCDTDAEILYELLTQHWHLKTPNLVISVTGGAKNFALKPRMRKIFSRLIYIAQSKGAWIL
TGGTHYGLMKYIGEVVRDNTISRSSEENIVAIGIAAWGMVSNRDTLIRNCDAEGYFLAQY
LMDDFTRDPLYILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP
IVCFAQGGGKETLKAINTSIKNKIPCVVVEGSGQIADVIASLVEVEDALTSSAVKEKLVR
FLPRTVSRLPEEETESWIKWLKEILECSHLLTVIKMEEAGDEIVSNAISYALYKAFSTSE
QDKDNWNGQLKLLLEWNQLDLANDEIFTNDRRWESADLQEVMFTALIKDRPKFVRLFLEN
GLNLRKFLTHDVLTELFSNHFSTLVYRNLQIAKNSYNDALLTFVWKLVANFRRGFRKEDR
NGRDEMDIELHDVSPITRHPLQALFIWAILQNKKELSKVIWEQTRGCTLAALGASKLLKT
LAKVKNDINAAGESEELANEYETRAVELFTECYSSDEDLAEQLLVYSCEAWGGSNCLELA
VEATDQHFIAQPGVQNFLSKQWYGEISRDTKNWKIILCLFIIPLVGCGFVSFRKKPVDKH
KKLLWYYVAFFTSPFVVFSWNVVFYIAFLLLFAYVLLMDFHSVPHPPELVLYSLVFVLFC
DEVRQWYVNGVNYFTDLWNVMDTLGLFYFIAGIVFRLHSSNKSSLYSGRVIFCLDYIIFT
LRLIHIFTVSRNLGPKIIMLQRMLIDVFFFLFLFAVWMVAFGVARQGILRQNEQRWRWIF
RSVIYEPYLAMFGQVPSDVDGTTYDFAHCTFTGNESKPLCVELDEHNLPRFPEWITIPLV
CIYMLSTNILLVNLLVAMFGYTVGTVQENNDQVWKFQRYFLVQEYCSRLNIPFPFIVFAY
FYMVVKKCFKCCCKEKNMESSVCCFKNEDNETLAWEGVMKENYLVKINTKANDTSEEMRH
RFRQLDTKLNDLKGLLKEIANKIK
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttcgggcagccaggctcagcatgaggaacagaaggaatgacactctggacagc
acccggaccctgtactccagcgcgtctcggagcacagacttgtcttacagtgaaagcgac
ttggtgaattttattcaagcaaattttaagaaacgagaatgtgtcttctttaccaaagat
tccaaggccacggagaatgtgtgcaagtgtggctatgcccagagccagcacatggaaggc
acccagatcaaccaaagtgagaaatggaactacaagaaacacaccaaggaatttcctacc
gacgcctttggggatattcagtttgagacactggggaagaaagggaagtatatacgtctg
tcctgcgacacggacgcggaaatcctttacgagctgctgacccagcactggcacctgaaa
acacccaacctggtcatttctgtgaccgggggcgccaagaacttcgccctgaagccgcgc
atgcgcaagatcttcagccggctcatctacatcgcgcagtccaaaggtgcttggattctc
acgggaggcacccattatggcctgatgaagtacatcggggaggtggtgagagataacacc
atcagcaggagttcagaggagaatattgtggccattggcatagcagcttggggcatggtc
tccaaccgggacaccctcatcaggaattgcgatgctgagggctattttttagcccagtac
cttatggatgacttcacaagagatccactgtatatcctggacaacaaccacacacatttg
ctgctcgtggacaatggctgtcatggacatcccactgtcgaagcaaagctccggaatcag
ctagagaagtatatctctgagcgcactattcaagattccaactatggtggcaagatcccc
attgtgtgttttgcccaaggaggtggaaaagagactttgaaagccatcaatacctccatc
aaaaataaaattccttgtgtggtggtggaaggctcgggccagatcgctgatgtgatcgct
agcctggtggaggtggaggatgccctgacatcttctgccgtcaaggagaagctggtgcgc
tttttaccccgcacggtgtcccggctgcctgaggaggagactgagagttggatcaaatgg
ctcaaagaaattctcgaatgttctcacctattaacagttattaaaatggaagaagctggg
gatgaaattgtgagcaatgccatctcctacgctctatacaaagccttcagcaccagtgag
caagacaaggataactggaatgggcagctgaagcttctgctggagtggaaccagctggac
ttagccaatgatgagattttcaccaatgaccgccgatgggagtctgctgaccttcaagaa
gtcatgtttacggctctcataaaggacagacccaagtttgtccgcctctttctggagaat
ggcttgaacctacggaagtttctcacccatgatgtcctcactgaactcttctccaaccac
ttcagcacgcttgtgtaccggaatctgcagatcgccaagaattcctataatgatgccctc
ctcacgtttgtctggaaactggttgcgaacttccgaagaggcttccggaaggaagacaga
aatggccgggacgagatggacatagaactccacgacgtgtctcctattactcggcacccc
ctgcaagctctcttcatctgggccattcttcagaataagaaggaactctccaaagtcatt
tgggagcagaccaggggctgcactctggcagccctgggagccagcaagcttctgaagact
ctggccaaagtgaagaacgacatcaatgctgctggggagtccgaggagctggctaatgag
tacgagacccgggctgttgagctgttcactgagtgttacagcagcgatgaagacttggca
gaacagctgctggtctattcctgtgaagcttggggtggaagcaactgtctggagctggcg
gtggaggccacagaccagcatttcatcgcccagcctggggtccagaattttctttctaag
caatggtatggagagatttcccgagacaccaagaactggaagattatcctgtgtctgttt
attatacccttggtgggctgtggctttgtatcatttaggaagaaacctgtcgacaagcac
aagaagctgctttggtactatgtggcgttcttcacctcccccttcgtggtcttctcctgg
aatgtggtcttctacatcgccttcctcctgctgtttgcctacgtgctgctcatggatttc
cattcggtgccacacccccccgagctggtcctgtactcgctggtctttgtcctcttctgt
gatgaagtgagacagtggtacgtaaatggggtgaattattttactgacctgtggaatgtg
atggacacgctggggcttttttacttcatagcaggaattgtatttcggctccactcttct
aataaaagctctttgtattctggacgagtcattttctgtctggactacattattttcact
ctaagattgatccacatttttactgtaagcagaaacttaggacccaagattataatgctg
cagaggatgctgatcgatgtgttcttcttcctgttcctctttgcggtgtggatggtggcc
tttggcgtggccaggcaagggatccttaggcagaatgagcagcgctggaggtggatattc
cgttcggtcatctacgagccctacctggccatgttcggccaggtgcccagtgacgtggat
ggtaccacgtatgactttgcccactgcaccttcactgggaatgagtccaagccactgtgt
gtggagctggatgagcacaacctgccccggttccccgagtggatcaccatccccctggtg
tgcatctacatgttatccaccaacatcctgctggtcaacctgctggtcgccatgtttggc
tacacggtgggcaccgtccaggagaacaatgaccaggtctggaagttccagaggtacttc
ctggtgcaggagtactgcagccgcctcaatatccccttccccttcatcgtcttcgcttac
ttctacatggtggtgaagaagtgcttcaagtgttgctgcaaggagaaaaacatggagtct
tctgtctgctgtttcaaaaatgaagacaatgagactctggcatgggagggtgtcatgaag
gaaaactaccttgtcaagatcaacacaaaagccaacgacacctcagaggaaatgaggcat
cgatttagacaactggatacaaagcttaatgatctcaagggtcttctgaaagagattgct
aataaaatcaaataa

DBGET integrated database retrieval system