KEGG   Homo sapiens (human): 79071Help
Entry
79071             CDS       T01001                                 

Gene name
ELOVL6, FACE, FAE, LCE
Definition
(RefSeq) ELOVL fatty acid elongase 6
  KO
K10203  
elongation of very long chain fatty acids protein 6 [EC:2.3.1.199]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    79071 (ELOVL6)
  Lipid metabolism
   00062 Fatty acid elongation
    79071 (ELOVL6)
   01040 Biosynthesis of unsaturated fatty acids
    79071 (ELOVL6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     79071 (ELOVL6)
Lipid biosynthesis proteins [BR:hsa01004]
 Elongase
  PUFA
   79071 (ELOVL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9H5J4(Tchem)
UniProt: 
Position
4q25
AA seq 265 aa AA seqDB search
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
KPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSK
APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY
YALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYL
SYLVLFCHFFFEAYIGKMRKTTKAE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtcagtgttgactttacaagaatatgaattcgaaaagcagttcaacgagaat
gaagccatccaatggatgcaggaaaactggaagaaatctttcctgttttctgctctgtat
gctgcctttatattcggtggtcggcacctaatgaataaacgagcaaagtttgaactgagg
aagccattagtgctctggtctctgacccttgcagtcttcagtatattcggtgctcttcga
actggtgcttatatggtgtacattttgatgaccaaaggcctgaagcagtcagtttgtgac
cagggtttttacaatggacctgtcagcaaattctgggcttatgcatttgtgctaagcaaa
gcacccgaactaggagatacaatattcattattctgaggaagcagaagctgatcttcctg
cactggtatcaccacatcactgtgctcctgtactcttggtactcctacaaagacatggtt
gccgggggaggttggttcatgactatgaactatggcgtgcacgccgtgatgtactcttac
tatgccttgcgggcggcaggtttccgagtctcccggaagtttgccatgttcatcaccttg
tcccagatcactcagatgctgatgggctgtgtggttaactacctggtcttctgctggatg
cagcatgaccagtgtcactctcactttcagaacatcttctggtcctcactcatgtacctc
agctaccttgtgctcttctgccatttcttctttgaggcctacatcggcaaaatgaggaaa
acaacgaaagctgaatag

DBGET integrated database retrieval system