KEGG   Homo sapiens (human): 79132Help
Entry
79132             CDS       T01001                                 

Gene name
DHX58, D11LGP2, D11lgp2e, LGP2, RLR-3
Definition
DEXH (Asp-Glu-X-His) box polypeptide 58 (EC:3.6.4.13)
Orthology
K12649  
ATP-dependent RNA helicase DHX58 [EC:3.6.3.14]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    79132 (DHX58)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.14  H+-transporting two-sector ATPase
     79132 (DHX58)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.2
AA seq 678 aa AA seqDB search
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLLICTAELLQMALTSPEEEEHV
ELTVFSLIVVDECHHTHKDTVYNVIMSQYLELKLQRAQPLPQVLGLTASPGTGGASKLDG
AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQI
HDHLEMPELSRKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV
DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPKLEMLEKILQR
QFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRAQLLIGAGNSSQSTHMTQRDQ
QEVIQKFQDGTLNLLVATSVAEEGLDIPHCNVVVRYGLLTNEISMVQARGRARADQSVYA
FVATEGSRELKRELINEALETLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQR
ENQRQQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV
FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVP
DFDFLQHCAENLSDLSLD
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggagcttcggtcctaccaatgggaggtgatcatgcctgccctggagggcaagaatatc
atcatctggctgcccacgggtgccgggaagacccgggcggctgcttatgtggccaagcgg
cacctagagactgtggatggagccaaggtggttgtattggtcaacagggtgcacctggtg
acccagcatggtgaagagttcaggcgcatgctggatggacgctggaccgtgacaaccctg
agtggggacatgggaccacgtgctggctttggccacctggcccggtgccatgacctgctc
atctgcacagcagagcttctgcagatggcactgaccagccccgaggaggaggagcacgtg
gagctcactgtcttctccctgatcgtggtggatgagtgccaccacacgcacaaggacacc
gtctacaacgtcatcatgagccagtacctagaacttaaactccagagggcacagccgcta
ccccaggtgctgggtctcacagcctccccaggcactggcggggcctccaaactcgatggg
gccatcaaccacgtcctgcagctctgtgccaacttggacacgtggtgcatcatgtcaccc
cagaactgctgcccccagctgcaggagcacagccaacagccttgcaaacagtacaacctc
tgccacaggcgcagccaggatccgtttggggacttgctgaagaagctcatggaccaaatc
catgaccacctggagatgcctgagttgagccggaaatttgggacgcaaatgtatgagcag
caggtggtgaagctgagtgaggctgcggctttggctgggcttcaggagcaacgggtgtat
gcgcttcacctgaggcgctacaatgacgcgctgctcatccatgacaccgtccgcgccgtg
gatgccttggctgcgctgcaggatttctatcacagggagcacgtcactaaaacccagatc
ctgtgtgccgagcgccggctgctggccctgttcgatgaccgcaagaatgagctggcccac
ttggcaactcatggcccagagaatccaaaactggagatgctggaaaagatcctgcaaagg
cagttcagtagctctaacagccctcggggtatcatcttcacccgcacccgccaaagcgca
cactccctcctgctctggctccagcagcagcagggcctgcagactgtggacatccgggcc
cagctactgattggggctgggaacagcagccagagcacccacatgacccagagggaccag
caagaagtgatccagaagttccaagatggaaccctgaaccttctggtggccacgagtgtg
gcggaggaggggctggacatcccacattgcaatgtggtggtgcgttatgggctcttgacc
aatgaaatctccatggtccaggccaggggccgtgcccgggccgatcagagtgtatacgcg
tttgtagcaactgaaggtagccgggagctgaagcgggagctgatcaacgaggcgctggag
acgctgatggagcaggcagtggctgctgtgcagaaaatggaccaggccgagtaccaggcc
aagatccgggatctgcagcaggcagccttgaccaagcgggcggcccaggcagcccagcgg
gagaaccagcggcagcagttcccagtggagcacgtgcagctactctgcatcaactgcatg
gtggctgtgggccatggcagcgacctgcggaaggtggagggcacccaccatgtcaatgtg
aaccccaacttctcgaactactataatgtctccagggatcctgtggtcatcaacaaagtc
ttcaaggactggaagcctgggggtgtcatcagctgcaggaactgtggggaggtctggggt
ctgcagatgatctacaagtcagtgaagctgccagtgctcaaagtccgcagcatgctgctg
gagacccctcaggggcggatccaggccaaaaagtggtcccgcgtgcccttctccgtgcct
gactttgacttcctgcagcattgtgccgagaacttgtcggacctctccctggactga

DBGET integrated database retrieval system