KEGG   Homo sapiens (human): 79135Help
Entry
79135             CDS       T01001                                 

Gene name
APOO, FAM121B, MIC26, Mic23, My025
Definition
(RefSeq) apolipoprotein O
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.11
AA seq 198 aa AA seqDB search
MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL
EESISQLRHYCEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFA
GLIGLLLARGSKIKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDL
WKENFQKPGNVKNSPGTK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggtaattcagaggtccgtggggccagccagcctgagcttgctcaccttcaaa
gtctatgcagcaccaaaaaaggactcacctcccaaaaattccgtgaaggttgatgagctt
tcactctactcagttcctgagggtcaatcgaagtatgtggaggaggcaaggagccagctt
gaagaaagcatctcacagctccgacactattgcgagccatacacaacctggtgtcaggaa
acgtactcccaaactaagcccaagatgcaaagtttggttcaatgggggttagacagctat
gactatctccaaaatgcacctcctggattttttccgagacttggtgttattggttttgct
ggccttattggactccttttggctagaggttcaaaaataaagaagctagtgtatccgcct
ggtttcatgggattagctgcctccctctattatccacaacaagccatcgtgtttgcccag
gtcagtggggagagattatatgactggggtttacgaggatatatagtcatagaagatttg
tggaaggagaactttcaaaagccaggaaatgtgaagaattcacctggaactaagtag

DBGET integrated database retrieval system