KEGG   Homo sapiens (human): 79139Help
Entry
79139             CDS       T01001                                 

Gene name
DERL1, DER-1, DER1
Definition
derlin 1
Orthology
K11519  
Derlin-1
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Amyotrophic lateral sclerosis (ALS)
Module
HRD1/SEL1 ERAD complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    79139 (DERL1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    79139 (DERL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q24.13
AA seq 231 aa AA seqDB search
MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF
YFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSYPMDLGGRNFL
STPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacatcggagactggttcaggagcatcccggcgatcacgcgctattggttcgcc
gccaccgtcgccgtgcccttggtcggcaaactcggcctcatcagcccggcctacctcttc
ctctggcccgaagccttcctttatcgctttcagatttggaggccaatcactgccaccttt
tatttccctgtgggtccaggaactggatttctttatttggtcaatttatatttcttatat
cagtattctacgcgacttgaaacaggagcttttgatgggaggccagcagactatttattc
atgctcctctttaactggatttgcatcgtgattactggcttagcaatggatatgcagttg
ctgatgattcctctgatcatgtcagtactttatgtctgggcccagctgaacagagacatg
attgtatcattttggtttggaacacgatttaaggcctgctatttaccctgggttatcctt
ggattcaactatatcatcggaggctcatacccaatggacttgggaggaagaaattttcta
tccacacctcagtttttgtaccgctggctgcccagtaggagaggaggagtatcaggattt
ggtgtgccccctgctagcatgaggcgagctgctgatcagaatggcggaggcgggagacac
aactggggccagggctttcgacttggagaccagtga

DBGET integrated database retrieval system