KEGG   Homo sapiens (human): 79143Help
Entry
79143             CDS       T01001                                 

Gene name
MBOAT7, BB1, LENG4, LPIAT, LRC4, MBOA7, OACT7, hMBOA-7
Definition
(RefSeq) membrane bound O-acyltransferase domain containing 7 (EC:2.3.1.n4)
  KO
K13516  
lysophospholipid acyltransferase 7 [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    79143 (MBOAT7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     79143 (MBOAT7)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   79143 (MBOAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.4
AA seq 472 aa AA seqDB search
MSPEEWTYLVVLLISIPIGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLVTILGT
WALIQAQPCSCHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKLVSLASEVQ
DLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQP
FPGAVPSLRPLLRRAWPAPLFGLLFLLSSHLFPLEAVREDAFYARPLPARLFYMIPVFFA
FRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQCPPPSSPEKAASLEYDYETIR
NIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHP
GYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSLA
DTLRYWASIYFCIHFLALAALGLGLALGGGSPSRRKAASQPTSLAPEKLREE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctgaagaatggacgtatctagtggttcttcttatctccatccccatcggcttc
ctctttaagaaagccggtcctgggctgaagagatggggagcagccgctgtgggcctgggg
ctcaccctgttcacctgtggcccccacactttgcattctctggtcaccatcctcgggacc
tgggccctcattcaggcccagccctgctcctgccacgccctggctctggcctggactttc
tcctatctcctgttcttccgagccctcagcctcctgggcctgcccactcccacgcccttc
accaatgccgtccagctgctgctgacgctgaagctggtgagcctggccagtgaagtccag
gacctgcatctggcccagaggaaggaaatggcctcaggcttcagcaaggggcccaccctg
gggctgctgcccgacgtgccctccctgatggagacactcagctacagctactgctacgtg
ggaatcatgacaggcccgttcttccgctaccgcacctacctggactggctggagcagccc
ttccccggggcagtgcccagcctgcggcccctgctgcgccgcgcctggccggccccgctc
ttcggcctgctgttcctgctctcctctcacctcttcccgctggaggccgtgcgcgaggac
gccttctacgcccgcccgctgcccgcccgcctcttctacatgatccccgtcttcttcgcc
ttccgcatgcgcttctacgtggcctggattgccgccgagtgcggctgcattgccgccggc
tttggggcctaccccgtggccgccaaagcccgggccggaggcggccccaccctccaatgc
ccaccccccagcagtccggagaaggcggcttccttggagtatgactatgagaccatccgc
aacatcgactgctacagcacagatttctgcgtgcgggtgcgcgatggcatgcggtactgg
aacatgacggtgcagtggtggctggcgcagtatatctacaagagcgcacctgcccgttcc
tatgtcctgcggagcgcctggaccatgctgctgagcgcctactggcacggcctccacccg
ggctactacctgagcttcctgaccatcccgctgtgcctggctgccgagggccggctggag
tcagccctgcgggggcggctgagcccagggggccagaaggcctgggactgggtgcactgg
ttcctgaagatgcgcgcctatgactacatgtgcatgggcttcgtgctgctctccttggcc
gacacccttcggtactgggcctccatctacttctgtatccacttcctggccctggcagcc
ctggggctggggctggctttaggtgggggcagccccagccggcggaaggcagcatcccag
cccaccagccttgccccggagaagctccgggaggagtaa

DBGET integrated database retrieval system