KEGG   Homo sapiens (human): 79143Help
Entry
79143             CDS       T01001                                 

Gene name
MBOAT7, BB1, LENG4, LPIAT, LRC4, MBOA7, OACT7, hMBOA-7
Definition
membrane bound O-acyltransferase domain containing 7 (EC:2.3.1.n4)
Orthology
K13516  
lysophospholipid acyltransferase 7 [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.4
AA seq 399 aa AA seqDB search
MGSSRCGPGAHPVHLWPPHFAFSGHHPRDLGPHSGPALLVSLASEVQDLHLAQRKEMASG
FSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLLR
RAWPAPLFGLLFLLSSHLFPLEAVREDAFYARPLPARLFYMIPVFFAFRMRFYVAWIAAE
CGCIAAGFGAYPVAAKARAGGGPTLQCPPPSSPEKAASLEYDYETIRNIDCYSTDFCVRV
RDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCL
AAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSLADTLRYWASIYFCI
HFLALAALGLGLALGGGSPSRRKAASQPTSLAPEKLREE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggggagcagccgctgtgggcctggggctcaccctgttcacctgtggcccccacacttt
gcattctctggtcaccatcctcgggacctgggccctcattcaggcccagccctgctggtg
agcctggccagtgaagtccaggacctgcatctggcccagaggaaggaaatggcctcaggc
ttcagcaaggggcccaccctggggctgctgcccgacgtgccctccctgatggagacactc
agctacagctactgctacgtgggaatcatgacaggcccgttcttccgctaccgcacctac
ctggactggctggagcagcccttccccggggcagtgcccagcctgcggcccctgctgcgc
cgcgcctggccggccccgctcttcggcctgctgttcctgctctcctctcacctcttcccg
ctggaggccgtgcgcgaggacgccttctacgcccgcccgctgcccgcccgcctcttctac
atgatccccgtcttcttcgccttccgcatgcgcttctacgtggcctggattgccgccgag
tgcggctgcattgccgccggctttggggcctaccccgtggccgccaaagcccgggccgga
ggcggccccaccctccaatgcccaccccccagcagtccggagaaggcggcttccttggag
tatgactatgagaccatccgcaacatcgactgctacagcacagatttctgcgtgcgggtg
cgcgatggcatgcggtactggaacatgacggtgcagtggtggctggcgcagtatatctac
aagagcgcacctgcccgttcctatgtcctgcggagcgcctggaccatgctgctgagcgcc
tactggcacggcctccacccgggctactacctgagcttcctgaccatcccgctgtgcctg
gctgccgagggccggctggagtcagccctgcgggggcggctgagcccagggggccagaag
gcctgggactgggtgcactggttcctgaagatgcgcgcctatgactacatgtgcatgggc
ttcgtgctgctctccttggccgacacccttcggtactgggcctccatctacttctgtatc
cacttcctggccctggcagccctggggctggggctggctttaggtgggggcagccccagc
cggcggaaggcagcatcccagcccaccagccttgccccggagaagctccgggaggagtaa

DBGET integrated database retrieval system