KEGG   Homo sapiens (human): 7915Help
Entry
7915              CDS       T01001                                 

Gene name
ALDH5A1, SSADH, SSDH
Definition
(RefSeq) aldehyde dehydrogenase 5 family member A1 (EC:1.2.1.24)
  KO
K00139  
succinate-semialdehyde dehydrogenase [EC:1.2.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Disease
H00835  
Succinic semialdehyde dehydrogenase (SSADH) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    7915 (ALDH5A1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    7915 (ALDH5A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     7915 (ALDH5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p22
AA seq 535 aa AA seqDB search
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH
TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF
AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF
EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR
VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctgcatttggctgcggagctgtggggcccggcgcctcgggtcgacgtttcca
ggctgccgcctccgcccccgcgccggcggcctggtccctgcctccgggcctgcgcccggc
ccggcccagctccgctgctacgctgggcgcctggcgggcctctctgcggcgctgctgcgc
accgacagcttcgtgggcggccgctggctcccggccgccgccaccttccccgtgcaagac
ccggccagcggcgccgctctgggcatggtagccgactgcggggtgcgagaggcccgcgcc
gccgtgcgcgctgcctacgaggctttctgccgctggagggaggtctccgccaaggagagg
agttcattacttcggaagtggtacaatttaatgatacaaaataaggatgaccttgccaga
ataatcacagctgaaagtggaaagccactgaaggaggcacatggagaaattctctattcc
gcctttttcctagagtggttctctgaggaagcccgccgtgtttacggagacattatccac
accccggcaaaggacaggcgggccctggtcctcaagcagcccataggcgtggctgcagtc
atcaccccgtggaatttccccagtgccatgatcacccggaaggtgggggccgccctggca
gccggctgtactgtcgtggtgaagcctgccgaagacacgcccttctccgccctggccctg
gctgagcttgcaagccaggctgggattccttcaggtgtatacaatgttattccctgttct
cgaaagaatgccaaggaagtaggggaggcaatttgtactgatcctctggtgtccaaaatt
tcctttactggttcaacaactacaggaaagatcctgttgcaccacgcagcaaactctgtg
aaaagggtctctatggagctgggcggccttgctccatttatagtatttgacagtgccaac
gtggaccaggctgtagcaggggccatggcatctaaatttaggaacactggacagacttgt
gtttgctcaaaccaattcttggtgcaaaggggcatccatgatgcctttgtaaaagcattc
gccgaggccatgaagaagaacctgcgcgtaggtaatggatttgaggaaggaactactcag
ggcccattaattaatgaaaaagcggtagaaaaggtggagaaacaggtgaatgatgccgtt
tctaaaggtgccaccgttgtgacaggtggaaaacgacaccaacttggaaaaaatttcttt
gagcctaccctgctgtgcaatgtcacccaggacatgctgtgcactcatgaagagactttc
gggcctctggcaccagttatcaagttcgatacagaggaggaggctatagcaatcgctaac
gcagctgatgttgggttagcaggttatttttactctcaagacccagcccagatctggaga
gtggcagagcagctggaagtgggcatggttggcgtcaacgaaggattaatttcctctgtg
gagtgcccttttggtggagtgaagcagtccggccttgggcgagaggggtccaagtatggc
attgatgagtatctggaactcaagtatgtgtgttacgggggcttgtag

DBGET integrated database retrieval system