KEGG   Homo sapiens (human): 79188Help
Entry
79188             CDS       T01001                                 

Gene name
TMEM43, ARVC5, ARVD5, EDMD7, LUMA
Definition
transmembrane protein 43
Organism
hsa  Homo sapiens (human)
Disease
H00293  
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p25.1
AA seq 400 aa AA seqDB search
MAANYSSTSTRREHVKVKTSSQPGFLERLSETSGGMFVGLMAFLLSFYLIFTNEGRALKT
ATSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVE
MYQWVETEESREYTEDGQVKKETRYSYNTEWRSEIINSKNFDREIGHKNPSAMAVESFMA
TAPFVQIGRFFLSSGLIDKVDNFKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLR
VSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHRE
LRSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLT
LLTVAAGWLFYRPLWALLIAGLALVPILVARTRVPAKKLE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgaattattccagtaccagtacccggagagaacatgtcaaagttaaaaccagc
tcccagccaggcttcctggaacggctgagcgagacctcgggtgggatgtttgtggggctc
atggccttcctgctctccttctacctaattttcaccaatgagggccgcgcattgaagacg
gcaacctcattggctgaggggctctcgcttgtggtgtctcccgacagcatccacagtgtg
gctccggagaatgaaggaaggctggtgcacatcattggcgccttacggacatccaagctt
ttgtctgatccaaactatggggtccatcttccggctgtgaaactgcggaggcacgtggag
atgtaccaatgggtagaaactgaggagtccagggagtacaccgaggatgggcaggtgaag
aaggagacgaggtattcctacaacactgaatggaggtcagaaatcatcaacagcaaaaac
ttcgaccgagagattggccacaaaaaccccagtgccatggcagtggagtcattcatggca
acagccccctttgtccaaattggcaggtttttcctctcgtcaggcctcatcgacaaagtc
gacaacttcaagtccctgagcctatccaagctggaggaccctcatgtggacatcattcgc
cgtggagactttttctaccacagcgaaaatcccaagtatccagaggtgggagacttgcgt
gtctccttttcctatgctggactgagcggcgatgaccctgacctgggcccagctcacgtg
gtcactgtgattgcccggcagcggggtgaccagctagtcccattctccaccaagtctggg
gataccttactgctcctgcaccacggggacttctcagcagaggaggtgtttcatagagaa
ctaaggagcaactccatgaagacctggggcctgcgggcagctggctggatggccatgttc
atgggcctcaaccttatgacacggatcctctacaccttggtggactggtttcctgttttc
cgagacctggtcaacattggcctgaaagcctttgccttctgtgtggccacctcgctgacc
ctgctgaccgtggcggctggctggctcttctaccgacccctgtgggccctcctcattgcc
ggcctggcccttgtgcccatccttgttgctcggacacgggtgccagccaaaaagttggag
tga

DBGET integrated database retrieval system