KEGG   Homo sapiens (human): 7919Help
Entry
7919              CDS       T01001                                 

Gene name
DDX39B, BAT1, D6S81E, UAP56
Definition
DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B (EC:3.6.4.13)
Orthology
K12812  
ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
mRNA surveillance pathway
Spliceosome
Influenza A
Module
TREX complex
Exon junction complex (EJC)
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:hsa03015]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 428 aa AA seqDB search
MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAI
VDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMC
HTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALA
RNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCR
KFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRC
IALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAF
NYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDI
SSYIEQTR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacgatgtggacaatgagctcttggactatgaagatgatgaggtggagaca
gcagctgggggagatggggctgaggcccctgccaagaaggatgtcaagggctcctatgtc
tccatccacagctctggctttcgtgacttcctgctcaagccagagttgctccgggccatt
gtcgactgtggctttgagcatccgtcagaagtccagcatgagtgcatccctcaggccatt
ctgggaatggatgtcctgtgccaggccaagtcgggcatgggaaagacagcagtgtttgtc
ttggccacactgcaacagctggagccagttactgggcaggtgtctgtactggtgatgtgt
cacactcgggagttggcttttcagatcagcaaggaatatgagcgcttctctaaatacatg
cccaatgtcaaggttgctgttttttttggtggtctgtctatcaagaaggatgaagaggtg
ctgaagaagaactgcccgcatatcgtcgtggggactccaggccgtatcctagccctggct
cgaaataagagcctcaacctcaaacacattaaacactttattttggatgaatgtgataag
atgcttgaacagctcgacatgcgtcgggatgtccaggaaatttttcgcatgaccccccac
gagaagcaggtcatgatgttcagtgctaccttgagcaaagagatccgtccagtctgccgc
aagttcatgcaagatccaatggagatcttcgtggatgatgagacgaagttgacgctgcat
gggttgcagcagtactacgtgaaactgaaggacaacgagaagaaccggaagctctttgac
cttctggatgtccttgagttcaaccaggtggtgatctttgtgaagtctgtgcagcggtgc
attgccttggcccagctactagtggagcagaacttcccagccattgccatccaccgtggg
atgccccaggaggagaggctttctcggtatcagcagtttaaagattttcaacgacgaatt
cttgtggctaccaacctatttggccgaggcatggacatcgagcgggtgaacattgctttt
aattatgacatgcctgaggattctgacacctacctgcatcgggtggccagagcaggccgg
tttggcaccaagggcttggctatcacatttgtgtccgatgagaatgatgccaagatcctc
aatgatgtgcaggatcgctttgaggtcaatattagtgagctgcctgatgagatagacatc
tcctcctacattgaacagacacggtag

DBGET integrated database retrieval system