KEGG   Homo sapiens (human): 79228Help
Entry
79228             CDS       T01001                                 

Gene name
THOC6, BBIS, WDR58, fSAP35
Definition
THO complex 6 homolog (Drosophila)
Orthology
K13175  
THO complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
THC complex
TREX complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 296 aa AA seqDB search
MERAVPLAVPLGQTEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSE
AKEESKKPVVTFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPY
RTSLEVPEINALLLVPKENSLILAGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERS
PEVLSGGEDGAVRLWDLRTAKEVQTIEVYKHEECSRPHNGRWIGCLATDSDWMVCGGGPA
LTLWHLRSSTPTTIFPIRAPQKHVTFYQDLVLTAAGNSCRVDVFTNLGYRAFSLSF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagctgtgccgctcgcggtgcctctgggtcagacagaggtgttccaggccttg
cagcggctccatatgaccatcttctcccagagcgtctcaccatgtgggaagtttctggcg
gctggcaacaattacgggcagattgccatcttcagcttgtcctctgctttgagctcagaa
gccaaagaggaaagtaagaagccggtggtgactttccaagcccatgatgggcccgtctat
agcatggtttccaccgatcgacatctgcttagtgctggggatggggaggtgaaggcctgg
ctttgggcggagatgctcaagaagggctgtaaggagctgtggcgtcgtcagcctccatac
aggaccagcctggaagtgcctgagatcaacgctttgctgctggtccccaaggagaattcc
ctcatcctggctgggggagactgtcagttgcacactatggaccttgaaactgggactttc
acgagggtcctccggggccacacagactacatccactgcctggcactgcgggaaaggagc
ccagaggtgctgtcaggtggcgaggatggagctgttcgactttgggacctgcgcacagcc
aaggaggtccagacgatcgaggtctataagcacgaggagtgctcgaggccccacaatggg
cgctggattggatgtttggcaactgattccgactggatggtctgtggagggggcccagcc
ctcaccctctggcacctccgatcctccacacccaccaccatcttccccatccgggcgcca
cagaagcacgtcaccttctaccaggacctggtcctgacagctgcaggcaacagctgccgg
gtggatgtcttcaccaacctgggttaccgagccttctccctgtccttctga

DBGET integrated database retrieval system