KEGG   Homo sapiens (human): 7923Help
Entry
7923              CDS       T01001                                 

Gene name
HSD17B8, D6S2245E, FABG, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, dJ1033B10.9
Definition
hydroxysteroid (17-beta) dehydrogenase 8 (EC:1.1.1.62 1.1.1.239)
Orthology
K13370  
17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.239]
Organism
hsa  Homo sapiens (human)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    7923 (HSD17B8)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     7923 (HSD17B8)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     7923 (HSD17B8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.3
AA seq 261 aa AA seqDB search
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGS
KEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDW
DKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLT
QTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
ASEDSGYITGTSVEVTGGLFM
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcagctccagaaccgactccgctccgcactggccttggtcacaggtgcgggg
agcggcatcggccgagcggtcagtgtacgcctggccggagagggggccaccgtagctgcc
tgcgacctggaccgggcagcggcacaggagacggtgcggctgctgggcgggccagggagc
aaggaggggccgccccgagggaaccatgctgccttccaggctgacgtgtctgaggccagg
gccgccaggtgcctgctggaacaagtgcaggcctgcttttctcgcccaccatctgtcgtt
gtgtcctgtgcgggcatcacccaggatgagtttctgctgcacatgtctgaggatgactgg
gacaaagtcatagctgtcaacctcaagggcaccttcctagtcactcaggctgcagcacaa
gccctggtgtccaatggttgtcgtggttccatcatcaacatcagtagcatcgtaggaaag
gtggggaacgtggggcagacaaactatgcagcatccaaggctggagtgattgggctgacc
cagaccgcagcccgggagcttggacgacatgggatccgctgtaactctgtcctcccaggg
ttcattgcaacacccatgacacagaaagtgccacagaaagtggtggacaagattactgaa
atgatcccgatgggacacttgggggaccctgaggatgtggcagatgtggtcgcattcttg
gcatctgaagatagtggatacatcacagggacctcagtggaagtcactggaggtcttttc
atgtaa

DBGET integrated database retrieval system