KEGG   Homo sapiens (human): 79317Help
Entry
79317             CDS       T01001                                 

Gene name
OR4K5, OR14-16
Definition
(RefSeq) olfactory receptor family 4 subfamily K member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    79317 (OR4K5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    79317 (OR4K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 79317
NCBI-ProteinID: NP_001005483
HGNC: 14745
Ensembl: ENSG00000176281
Vega: OTTHUMG00000170627
Pharos: Q8NGD3(Tdark)
UniProt: Q8NGD3 A0A126GVN5
Position
14q11.2
AA seq 323 aa AA seqDB search
MDKSNSSVVSEFVLLGLCSSQKLQLFYFCFFSVLYTVIVLGNLLIILTVTSDTSLHSPMY
FLLGNLSFVDICQASFATPKMIADFLSAHETISFSGCIAQIFFIHLFTGGEMVLLVSMAY
DRYVAICKPLYYVVIMSRRTCTVLVMISWAVSLVHTLSQLSFTVNLPFCGPNVVDSFFCD
LPRVTKLACLDSYIIEILIVVNSGILSLSTFSLLVSSYIIILVTVWLKSSAAMAKAFSTL
ASHIAVVILFFGPCIFIYVWPFTISPLDKFLAIFYTVFTPVLNPIIYTLRNRDMKAAVRK
IVNHYLRPRRISEMSLVVRTSFH
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggataagtccaattcttcagtggtgtctgaatttgtactgttgggactctgtagttct
caaaaactccagcttttctatttttgtttcttctctgtgttgtatacagtcattgtgctg
ggaaatcttctcattatcctcacagtgacttctgataccagcctgcactcccctatgtac
tttctcttgggaaacctttcctttgttgacatttgtcaggcttcttttgctacccctaaa
atgattgcagattttctgagtgcacacgagaccatatctttcagtggctgcatagcccaa
attttctttattcacctttttactggaggggagatggtgctacttgtttcgatggcctat
gacaggtatgtagccatatgcaaacccttatactatgtggtcatcatgagccgaaggaca
tgcactgtcttggtaatgatctcctgggctgtgagcttggtgcacacattaagccagtta
tcatttactgtgaacctgcctttttgtggacctaatgtagtagacagctttttttgtgat
cttcctcgagtcaccaaacttgcctgcctggactcttacatcattgaaatactaattgtg
gtcaatagtggaattctttccctaagcactttctctctcttggtcagctcctacatcatt
attcttgttacagtttggctcaagtcttcagctgcaatggcaaaggcattttctacgctg
gcttcccatattgcagtagtaatattattctttggaccttgcatcttcatctatgtgtgg
ccctttaccatctctcctttggataaatttcttgccatattttacactgttttcaccccc
gtcctaaaccccattatttatacactaaggaatagggatatgaaggctgccgtaaggaaa
attgtgaaccattacctgaggccaaggagaatttctgaaatgtcactagtagtgagaact
tcctttcattaa

DBGET integrated database retrieval system