KEGG   Homo sapiens (human): 79339Help
Entry
79339             CDS       T01001                                 

Gene name
OR51B4, HOR5'Beta1
Definition
(RefSeq) olfactory receptor family 51 subfamily B member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    79339 (OR51B4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    79339 (OR51B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 79339
NCBI-ProteinID: NP_149419
HGNC: 14708
Ensembl: ENSG00000183251
Vega: OTTHUMG00000066665
Pharos: Q9Y5P0(Tdark)
UniProt: Q9Y5P0
Position
11p15.4
AA seq 310 aa AA seqDB search
MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYF
LAMLADTDLGMTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCF
IAIRTPLRYNCILTNSRVMNIGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQD
VIKLACADITFNHIYPIIQTSLTVFLDALIIIFSYILILKTVMGIASGQEEAKSLNTCVS
HISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLFPPFVNPIIYSIKTKQIQRSI
IRLFSGQSRA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtggtataacaacagtgctggccccttcttgctgactggcttcttgggctcagaggca
gttcactaccggatctctatgtccttctttgtcatctacttctccgtcctttttggaaat
ggcactcttcttgtcctcatttggaatgatcacagcctccatgagcccatgtactacttc
ctggctatgctggcagacacggaccttgggatgacattcactacaatgcccacagtcctg
ggtgtcctgctgctagaccagagggagattgcccatgctgcctgtttcacccaatccttc
attcattcactggccattgtagaatcaggtatcttgcttgttttggcctatgactgtttc
attgccatccgcacaccactgaggtacaactgcattcttaccaattcccgagtgatgaac
ataggactgggggtactgatgagaggttttatgtccattttgcccataattctttcactc
tactgctacccatattgtggttcccgtgccctcttgcacacattttgcctccatcaagat
gtcataaaactcgcctgtgctgatatcacgtttaatcacatatatccaattattcagact
tctttgactgtctttttagatgctctaatcatcatcttttcttatatactaatcctcaag
acagtgatgggcattgcgtctggacaagaggaagctaaatctctcaacacttgtgtctcc
catattagctgtgtcctagtatttcacatcactgtgatgggactgtcattcattcacagg
tttgggaaacatgcacctcatgtggtccccattaccatgagctatgtccattttctcttt
cctccattcgtgaatcctatcatttatagcatcaagaccaagcagattcaaagaagcatt
attcgcctattttctgggcagagtagggcttga

DBGET integrated database retrieval system