KEGG   Homo sapiens (human): 79365Help
Entry
79365             CDS       T01001                                 

Gene name
BHLHE41, BHLHB3, DEC2, SHARP1, hDEC2
Definition
basic helix-loop-helix family, member e41
Orthology
K03730  
class B basic helix-loop-helix protein 3
Organism
hsa  Homo sapiens (human)
Pathway
Circadian rhythm
Class
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:hsa04710]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p12.1
AA seq 482 aa AA seqDB search
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
GYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGSGGGPGGGAAAA
AAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLPFCFLSPSAAA
AYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKE
AP
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaggaattcctcatttgcaagagagacagttactggaacatagagattttata
ggactggactattcctctttgtatatgtgtaaacccaaaaggagcatgaaacgagacgac
accaaggatacctacaaattaccgcacagattaatagaaaagaaaagaagagaccgaatt
aatgaatgcattgctcagctgaaagatttactgcctgaacatctgaaattgacaactctg
ggacatctggagaaagctgtagtcttggaattaactttgaaacacttaaaagctttaacc
gccttaaccgagcaacagcatcagaagataattgctttacagaatggggagcgatctctg
aaatcgcccattcagtccgacttggatgcgttccactcgggatttcaaacatgcgccaaa
gaagtcttgcaatacctctcccggtttgagagctggacacccagggagccgcggtgtgtc
cagctgatcaaccacttgcacgccgtggccacccagttcttgcccaccccgcagctgttg
actcaacaggtccctctgagcaaaggcaccggcgctccctcggccgccgggtccgcggcc
gccccctgcctggagcgcgcggggcagaagctggagcccctcgcctactgcgtgcccgtc
atccagcggactcagcccagcgccgagctcgccgccgagaacgacacggacaccgacagc
ggctacggcggcgaagccgaggcccggccggaccgcgagaaaggcaaaggcgcgggggcg
agccgcgtcaccatcaagcaggagcctcccggggaggactcgccggcgcccaagaggatg
aagctggattcccgcggcggcggcagcggcggcggcccggggggcggcgcggcggcggcg
gcagccgcgcttctggggcccgaccctgccgccgcggccgcgctgctgagacccgacgcc
gccctgctcagctcgctggtggcgttcggcggaggcggaggcgcgcccttcccgcagccc
gcggccgccgcggcccccttctgcctgcccttctgcttcctctcgccttctgcagctgcc
gcctacgtgcagcccttcctggacaagagcggcctggagaagtatctgtacccggcggcg
gctgccgccccgttcccgctgctataccccggcatccccgccccggcggcagccgcggca
gccgccgccgccgctgccgccgccgccgccgcgttcccctgcctgtcctcggtgttgtcg
ccccctcccgagaaggcgggcgccgccgccgcgaccctcctgccgcacgaggtggcgccc
cttggggcgccgcacccccagcacccgcacggccgcacccacctgcccttcgccgggccc
cgcgagccggggaacccggagagctctgctcaggaagatccctcgcagccaggaaaggaa
gctccctga

DBGET integrated database retrieval system