KEGG   Homo sapiens (human): 79411Help
Entry
79411             CDS       T01001                                 

Gene name
GLB1L
Definition
(RefSeq) galactosidase beta 1 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6UWU2(Tdark)
UniProt: 
Position
2q35
AA seq 654 aa AA seqDB search
MAPKKLSCLRSLLLPLSLTLLLPQADTRSFVVDRGHDRFLLDGAPFRYVSGSLHYFRVPR
VLWADRLLKMRWSGLNAIQFYVPWNYHEPQPGVYNFNGSRDLIAFLNEAALANLLVILRP
GPYICAEWEMGGLPSWLLRKPEIHLRTSDPDFLAAVDSWFKVLLPKIYPWLYHNGGNIIS
IQVENEYGSYRACDFSYMRHLAGLFRALLGEKILLFTTDGPEGLKCGSLRGLYTTVDFGP
ADNMTKIFTLLRKYEPHGPLVNSEYYTGWLDYWGQNHSTRSVSAVTKGLENMLKLGASVN
MYMFHGGTNFGYWNGADKKGRFLPITTSYDYDAPISEAGDPTPKLFALRDVISKFQEVPL
GPLPPPSPKMMLGPVTLHLVGHLLAFLDLLCPRGPIHSILPMTFEAVKQDHGFMLYRTYM
THTIFEPTPFWVPNNGVHDRAYVMVDGVFQGVVERNMRDKLFLTGKLGSKLDILVENMGR
LSFGSNSSDFKGLLKPPILGQTILTQWMMFPLKIDNLVKWWFPLQLPKWPYPQAPSGPTF
YSKTFPILGSVGDTFLYLPGWTKGQVWINGFNLGRYWTKQGPQQTLYVPRFLLFPRGALN
KITLLELEDVPLQPQVQFLDKPILNSTSTLHRTHINSLSADTLSASEPMELSGH
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaagaagctgtcctgccttcgttccctgctgctgccgctcagcctgacgcta
ctgctgccccaggcagacactcggtcgttcgtagtggataggggtcatgaccggtttctc
ctagacggggccccgttccgctatgtgtctggcagcctgcactactttcgggtaccgcgg
gtgctttgggccgaccggcttttgaagatgcgatggagcggcctcaacgccatacagttt
tatgtgccctggaactaccacgagccacagcctggggtctataactttaatggcagccgg
gacctcattgcctttctgaatgaggcagctctagcgaacctgttggtcatactgagacca
ggaccttacatctgtgcagagtgggagatggggggtctcccatcctggttgcttcgaaaa
cctgaaattcatctaagaacctcagatccagacttccttgccgcagtggactcctggttc
aaggtcttgctgcccaagatatatccatggctttatcacaatgggggcaacatcattagc
attcaggtggagaatgaatatggtagctacagagcctgtgacttcagctacatgaggcac
ttggctgggctcttccgtgcactgctaggagaaaagatcttgctcttcaccacagatggg
cctgaaggactcaagtgtggctccctccggggactctataccactgtagattttggccca
gctgacaacatgaccaaaatctttaccctgcttcggaagtatgaaccccatgggccattg
gtaaactctgagtactacacaggctggctggattactggggccagaatcactccacacgg
tctgtgtcagctgtaaccaaaggactagagaacatgctcaagttgggagccagtgtgaac
atgtacatgttccatggaggtaccaactttggatattggaatggtgccgataagaaggga
cgcttccttccgattactaccagctatgactatgatgcacctatatctgaagcaggggac
cccacacctaagctttttgctcttcgagatgtcatcagcaagttccaggaagttcctttg
ggacctttacctcccccgagccccaagatgatgcttggacctgtgactctgcacctggtt
gggcatttactggctttcctagacttgctttgcccccgtgggcccattcattcaatcttg
ccaatgacctttgaggctgtcaagcaggaccatggcttcatgttgtaccgaacctatatg
acccataccatttttgagccaacaccattctgggtgccaaataatggagtccatgaccgt
gcctatgtgatggtggatggggtgttccagggtgttgtggagcgaaatatgagagacaaa
ctatttttgacggggaaactggggtccaaactggatatcttggtggagaacatggggagg
ctcagctttgggtctaacagcagtgacttcaagggcctgttgaagccaccaattctgggg
caaacaatccttacccagtggatgatgttccctctgaaaattgataaccttgtgaagtgg
tggtttcccctccagttgccaaaatggccatatcctcaagctccttctggccccacattc
tactccaaaacatttccaattttaggctcagttggggacacatttctatatctacctgga
tggaccaagggccaagtctggatcaatgggtttaacttgggccggtactggacaaagcag
gggccacaacagaccctctacgtgccaagattcctgctgtttcctaggggagccctcaac
aaaattacattgctggaactagaagatgtacctctccagccccaagtccaatttttggat
aagcctatcctcaatagcactagtactttgcacaggacacatatcaattccctttcagct
gatacactgagtgcctctgaaccaatggagttaagtgggcactga

DBGET integrated database retrieval system