KEGG   Homo sapiens (human): 79444Help
Entry
79444             CDS       T01001                                 

Gene name
BIRC7, KIAP, LIVIN, ML-IAP, MLIAP, RNF50
Definition
baculoviral IAP repeat containing 7
Orthology
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.3
AA seq 280 aa AA seqDB search
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDR
AVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgggacctaaagacagtgccaagtgcctgcaccgtggaccacagccgagccactgggca
gccggtgatggtcccacgcaggagcgctgtggaccccgctctctgggcagccctgtccta
ggcctggacacctgcagagcctgggaccacgtggatgggcagatcctgggccagctgcgg
cccctgacagaggaggaagaggaggagggcgccggggccaccttgtccagggggcctgcc
ttccccggcatgggctctgaggagttgcgtctggcctccttctatgactggccgctgact
gctgaggtgccacccgagctgctggctgctgccggcttcttccacacaggccatcaggac
aaggtgaggtgcttcttctgctatgggggcctgcagagctggaagcgcggggacgacccc
tggacggagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcactcccagctgctgggctcctgggacccgtgg
gaagaaccggaagacgcagcccctgtggccccctccgtccctgcctctgggtaccctgag
ctgcccacacccaggagagaggtccagtctgaaagtgcccaggagccaggagccagggat
gtggaggcgcagctgcggcggctgcaggaggagaggacgtgcaaggtgtgcctggaccgc
gccgtgtccatcgtctttgtgccgtgcggccacctggtctgtgctgagtgtgcccccggc
ctgcagctgtgccccatctgcagagcccccgtccgcagccgcgtgcgcaccttcctgtcc
tag

DBGET integrated database retrieval system