KEGG   Homo sapiens (human): 79444Help
Entry
79444             CDS       T01001                                 

Gene name
BIRC7, KIAP, LIVIN, ML-IAP, MLIAP, RNF50
Definition
baculoviral IAP repeat containing 7
Orthology
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Apoptosis
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    79444 (BIRC7)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    79444 (BIRC7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    79444 (BIRC7)
   05222 Small cell lung cancer
    79444 (BIRC7)
  Infectious diseases
   05145 Toxoplasmosis
    79444 (BIRC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.3
AA seq 280 aa AA seqDB search
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGARDVEAQLRRLQEERTCKVCLDR
AVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgggacctaaagacagtgccaagtgcctgcaccgtggaccacagccgagccactgggca
gccggtgatggtcccacgcaggagcgctgtggaccccgctctctgggcagccctgtccta
ggcctggacacctgcagagcctgggaccacgtggatgggcagatcctgggccagctgcgg
cccctgacagaggaggaagaggaggagggcgccggggccaccttgtccagggggcctgcc
ttccccggcatgggctctgaggagttgcgtctggcctccttctatgactggccgctgact
gctgaggtgccacccgagctgctggctgctgccggcttcttccacacaggccatcaggac
aaggtgaggtgcttcttctgctatgggggcctgcagagctggaagcgcggggacgacccc
tggacggagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcactcccagctgctgggctcctgggacccgtgg
gaagaaccggaagacgcagcccctgtggccccctccgtccctgcctctgggtaccctgag
ctgcccacacccaggagagaggtccagtctgaaagtgcccaggagccaggagccagggat
gtggaggcgcagctgcggcggctgcaggaggagaggacgtgcaaggtgtgcctggaccgc
gccgtgtccatcgtctttgtgccgtgcggccacctggtctgtgctgagtgtgcccccggc
ctgcagctgtgccccatctgcagagcccccgtccgcagccgcgtgcgcaccttcctgtcc
tag

DBGET integrated database retrieval system