KEGG   Homo sapiens (human): 79444Help
Entry
79444             CDS       T01001                                 

Gene name
BIRC7, KIAP, LIVIN, ML-IAP, MLIAP, RNF50
Definition
(RefSeq) baculoviral IAP repeat containing 7
  KO
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Toxoplasmosis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    79444 (BIRC7)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    79444 (BIRC7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    79444 (BIRC7)
   05222 Small cell lung cancer
    79444 (BIRC7)
  Infectious diseases
   05145 Toxoplasmosis
    79444 (BIRC7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    79444 (BIRC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.3
AA seq 298 aa AA seqDB search
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE
AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggacctaaagacagtgccaagtgcctgcaccgtggaccacagccgagccactgggca
gccggtgatggtcccacgcaggagcgctgtggaccccgctctctgggcagccctgtccta
ggcctggacacctgcagagcctgggaccacgtggatgggcagatcctgggccagctgcgg
cccctgacagaggaggaagaggaggagggcgccggggccaccttgtccagggggcctgcc
ttccccggcatgggctctgaggagttgcgtctggcctccttctatgactggccgctgact
gctgaggtgccacccgagctgctggctgctgccggcttcttccacacaggccatcaggac
aaggtgaggtgcttcttctgctatgggggcctgcagagctggaagcgcggggacgacccc
tggacggagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcactcccagctgctgggctcctgggacccgtgg
gaagaaccggaagacgcagcccctgtggccccctccgtccctgcctctgggtaccctgag
ctgcccacacccaggagagaggtccagtctgaaagtgcccaggagccaggaggggtcagt
ccagccgaggcccagagggcgtggtgggttcttgagcccccaggagccagggatgtggag
gcgcagctgcggcggctgcaggaggagaggacgtgcaaggtgtgcctggaccgcgccgtg
tccatcgtctttgtgccgtgcggccacctggtctgtgctgagtgtgcccccggcctgcag
ctgtgccccatctgcagagcccccgtccgcagccgcgtgcgcaccttcctgtcctag

DBGET integrated database retrieval system