KEGG   Homo sapiens (human): 79444Help
Entry
79444             CDS       T01001                                 

Gene name
BIRC7, KIAP, LIVIN, ML-IAP, MLIAP, RNF50
Definition
(RefSeq) baculoviral IAP repeat containing 7
  KO
K16061  baculoviral IAP repeat-containing protein 7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04215  Apoptosis - multiple species
hsa05145  Toxoplasmosis
hsa05200  Pathways in cancer
hsa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    79444 (BIRC7)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    79444 (BIRC7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    79444 (BIRC7)
   05222 Small cell lung cancer
    79444 (BIRC7)
  Infectious diseases
   05145 Toxoplasmosis
    79444 (BIRC7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    79444 (BIRC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 zf-C3HC4 zf-RING_2 zf-RING_UBOX DUF2039 zf-C3HC4_2
Motif
Other DBs
NCBI-GeneID: 79444
NCBI-ProteinID: NP_647478
OMIM: 605737
HGNC: 13702
Ensembl: ENSG00000101197
Vega: OTTHUMG00000032957
Pharos: Q96CA5(Tbio)
UniProt: Q96CA5
Structure
PDB: 

Jmol
Position
20q13.33
AA seq 298 aa AA seqDB search
MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLR
PLTEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPLTAEVPPELLAAAGFFHTGHQD
KVRCFFCYGGLQSWKRGDDPWTEHAKWFPSCQFLLRSKGRDFVHSVQETHSQLLGSWDPW
EEPEDAAPVAPSVPASGYPELPTPRREVQSESAQEPGGVSPAEAQRAWWVLEPPGARDVE
AQLRRLQEERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFLS
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgggacctaaagacagtgccaagtgcctgcaccgtggaccacagccgagccactgggca
gccggtgatggtcccacgcaggagcgctgtggaccccgctctctgggcagccctgtccta
ggcctggacacctgcagagcctgggaccacgtggatgggcagatcctgggccagctgcgg
cccctgacagaggaggaagaggaggagggcgccggggccaccttgtccagggggcctgcc
ttccccggcatgggctctgaggagttgcgtctggcctccttctatgactggccgctgact
gctgaggtgccacccgagctgctggctgctgccggcttcttccacacaggccatcaggac
aaggtgaggtgcttcttctgctatgggggcctgcagagctggaagcgcggggacgacccc
tggacggagcatgccaagtggttccccagctgtcagttcctgctccggtcaaaaggaaga
gactttgtccacagtgtgcaggagactcactcccagctgctgggctcctgggacccgtgg
gaagaaccggaagacgcagcccctgtggccccctccgtccctgcctctgggtaccctgag
ctgcccacacccaggagagaggtccagtctgaaagtgcccaggagccaggaggggtcagt
ccagccgaggcccagagggcgtggtgggttcttgagcccccaggagccagggatgtggag
gcgcagctgcggcggctgcaggaggagaggacgtgcaaggtgtgcctggaccgcgccgtg
tccatcgtctttgtgccgtgcggccacctggtctgtgctgagtgtgcccccggcctgcag
ctgtgccccatctgcagagcccccgtccgcagccgcgtgcgcaccttcctgtcctag

DBGET integrated database retrieval system