KEGG   Homo sapiens (human): 79473Help
Entry
79473             CDS       T01001                                 

Gene name
OR52N1, OR11-61
Definition
(RefSeq) olfactory receptor family 52 subfamily N member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    79473 (OR52N1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    79473 (OR52N1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 79473
NCBI-ProteinID: NP_001001913
HGNC: 14853
Ensembl: ENSG00000181001
Vega: OTTHUMG00000168800
Pharos: Q8NH53(Tdark)
UniProt: Q8NH53
Position
11p15.4
AA seq 320 aa AA seqDB search
MSFLNGTSLTPASFILNGIPGLEDVHLWISFPLCTMYSIAITGNFGLMYLIYCDEALHRP
MYVFLALLSFTDVLMCTSTLPNTLFILWFNLKEIDFKACLAQMFFVHTFTGMESGVLMLM
ALDHCVAICFPLRYATILTNSVIAKAGFLTFLRGVMLVIPSTFLTKRLPYCKGNVIPHTY
CDHMSVAKISCGNVRVNAIYGLIVALLIGGFDILCITISYTMILQAVVSLSSADARQKAF
STCTAHFCAIVLTYVPAFFTFFTHHFGGHTIPLHIHIIMANLYLLMPPTMNPIVYGVKTR
QVRESVIRFFLKGKDNSHNF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttctaaatggcaccagcctaactccagcttcattcatcctaaatggcatccct
ggtttggaagatgtgcatttgtggatctccttcccactgtgtaccatgtacagcattgct
attacagggaacttcggccttatgtacctcatctactgtgatgaggccttacacagacct
atgtatgtcttccttgcccttctttccttcacagatgtgctcatgtgcaccagcaccctt
cccaacactctcttcatattgtggtttaatctcaaggagattgattttaaagcctgcctc
gcccagatgttctttgtgcacaccttcacagggatggagtctggggtgctcatgctcatg
gccctggaccactgtgtggccatctgcttccctctgcgttatgccaccatcctcactaat
tcagtcattgctaaagctgggttcctcacttttcttaggggtgtgatgcttgttatccct
tccactttcctcaccaagcgccttccatactgcaagggcaacgtcataccccacacctac
tgtgaccacatgtctgtggccaagatatcttgtggtaatgtcagggttaacgccatctat
ggtttgatagttgccctgctgattgggggctttgatatcctgtgcattacaatctcctac
actatgattcttcaagcagttgtgagtctatcatcagcagatgctcgacagaaggccttc
agcacctgcactgcccacttctgtgccatagtcctcacctatgttccagccttctttacc
ttctttacacaccattttgggggacacaccattcctctacacatacatattattatggct
aatctctacctactaatgcctcccacaatgaaccctattgtgtatggggtgaaaaccagg
caggtacgagaaagtgtcattaggttctttcttaagggaaaggacaattctcataacttt
taa

DBGET integrated database retrieval system