KEGG   Homo sapiens (human): 795Help
Entry
795               CDS       T01001                                 

Gene name
S100G, CABP, CABP1, CABP9K, CALB3
Definition
(RefSeq) S100 calcium binding protein G
  KO
K14734  S100 calcium binding protein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    795 (S100G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_4 DUF3848 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 795
NCBI-ProteinID: NP_004048
OMIM: 302020
HGNC: 1436
Ensembl: ENSG00000169906
Vega: OTTHUMG00000021194
Pharos: P29377(Tbio)
UniProt: P29377
Position
Xp22.2
AA seq 79 aa AA seqDB search
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN
GDGEVSFEEFQVLVKKISQ
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgagtactaaaaagtctcctgaggaactgaagaggatttttgaaaaatatgcagccaaa
gaaggtgatccagaccagttgtcaaaggatgaactgaagctattgattcaggctgaattc
cccagtttactcaaaggtccaaacaccctagatgatctctttcaagaactggacaagaat
ggagatggagaagttagttttgaagaattccaagtattagtaaaaaagatatcccagtga

DBGET integrated database retrieval system