KEGG   Homo sapiens (human): 795Help
Entry
795               CDS       T01001                                 

Gene name
S100G, CABP, CABP1, CABP9K, CALB3
Definition
S100 calcium binding protein G
Orthology
K14734  
S100 calcium binding protein G
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    795 (S100G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp22.2
AA seq 79 aa AA seqDB search
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKN
GDGEVSFEEFQVLVKKISQ
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgagtactaaaaagtctcctgaggaactgaagaggatttttgaaaaatatgcagccaaa
gaaggtgatccagaccagttgtcaaaggatgaactgaagctattgattcaggctgaattc
cccagtttactcaaaggtccaaacaccctagatgatctctttcaagaactggacaagaat
ggagatggagaagttagttttgaagaattccaagtattagtaaaaaagatatcccagtga

DBGET integrated database retrieval system