KEGG   Homo sapiens (human): 79544Help
Entry
79544             CDS       T01001                                 

Gene name
OR4K1, OR14-19
Definition
(RefSeq) olfactory receptor family 4 subfamily K member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    79544 (OR4K1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    79544 (OR4K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 79544
NCBI-ProteinID: NP_001004063
HGNC: 14726
Ensembl: ENSG00000155249
Vega: OTTHUMG00000170633
Pharos: Q8NGD4(Tdark)
UniProt: Q8NGD4
Position
14q11.2
AA seq 311 aa AA seqDB search
MAHTNESMVSEFVLLGLSNSWGLQLFFFAIFSIVYVTSVLGNVLIIVIISFDSHLNSPMY
FLLSNLSFIDICQSNFATPKMLVDFFIERKTISFEGCMAQIFVLHSFVGSEMMLLVAMAY
DRFIAICKPLHYSTIMNRRLCVIFVSISWAVGVLHSVSHLAFTVDLPFCGPNEVDSFFCD
LPLVIELACMDTYEMEIMTLTNSGLISLSCFLALIISYTIILIGVRCRSSSGSSKALSTL
TAHITVVILFFGPCIYFYIWPFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWK
LRNRHVNSWKN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctcacacaaatgaatcgatggtgtctgagtttgtacttttgggactctctaattcc
tggggacttcaacttttcttttttgccatcttctctatagtctatgtgacatcagtgcta
ggcaatgtcttaattattgtcattatttcttttgactcccatttgaactctcctatgtac
ttcttgctcagtaatctttctttcattgatatctgtcagtctaactttgccacccccaag
atgcttgtagacttttttattgagcgcaagactatctcctttgagggttgcatggcccag
atattcgttcttcacagttttgttgggagtgagatgatgttgcttgtagctatggcatat
gacagatttatagccatatgtaagcctctgcactacagtacaattatgaaccggaggctc
tgtgtaatttttgtgtctatttcctgggcggtgggcgttcttcattctgtgagccacttg
gcttttacagtggacctgccattctgtggtcccaatgaggtggatagcttcttttgtgac
cttcccttggtgatagagctggcttgcatggatacatatgaaatggaaattatgacccta
acgaacagtggcctgatatcattgagctgtttcctggctttaattatttcctacaccatc
attttgatcggtgtccgatgcaggtcctccagtgggtcatctaaggctctttctacatta
actgcccacatcacagtggtcattcttttcttcgggccttgcatttatttctatatatgg
ccttttagcagacttcctgtggacaaatttctttctgtgttctacactgtttgtactccc
ttgttgaaccccatcatctactctctgaggaatgaagatgttaaagcagccatgtggaag
ctgagaaaccgtcatgtgaactcctggaaaaactag

DBGET integrated database retrieval system