KEGG   Homo sapiens (human): 79602Help
Entry
79602             CDS       T01001                                 

Gene name
ADIPOR2, ACDCR2, PAQR2
Definition
adiponectin receptor 2
Orthology
K07297  
adiponectin receptor
Organism
hsa  Homo sapiens (human)
Pathway
AMPK signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    79602 (ADIPOR2)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    79602 (ADIPOR2)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    79602 (ADIPOR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12p13.31
AA seq 386 aa AA seqDB search
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSE
EHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDF
LLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQE
KVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFY
CNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAF
VHFHGVSNLQEFRFMIGGGCSEEDAL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagccaacagaaaaccgattggggtgcagcaggactccagagccagatataagg
ctcagaaaagggcaccaactggatggtacacgaagaggtgataatgacagccaccaagga
gatttggagcccattttagaggcatctgttctatcttcccatcataaaaaaagctctgag
gaacatgaatacagtgatgaagctcctcaggaagatgagggctttatgggcatgtcccct
ctcttacaagcccatcatgctatggaaaaaatggaagaatttgtttgtaaggtatgggaa
ggtcggtggcgagtgatccctcatgatgtactaccagactggctcaaggataatgacttc
ctcttgcatggacaccggcctcctatgccttctttccgggcctgttttaagagcattttc
agaatacacacagaaacaggcaacatttggacacatctcttaggttgtgtattcttcctg
tgcctggggatcttttatatgtttcgcccaaatatctcctttgtggcccctctgcaagag
aaggtggtctttggattatttttcttaggagccattctctgcctttctttttcatggctc
ttccacacagtctactgccactcagagggggtctctcggctcttctctaaactggattac
tctggtattgctcttctgattatgggaagttttgttccttggctttattattctttctac
tgtaatccacaaccttgcttcatctacttgattgtcatctgtgtgctgggcattgcagcc
attatagtctcccagtgggacatgtttgccacccctcagtatcggggagtaagagcagga
gtgtttttgggcctaggcctgagtggaatcattcctaccttgcactatgtcatctcggag
gggttccttaaggccgccaccatagggcagataggctggttgatgctgatggccagcctc
tacatcacaggagctgccctgtatgctgcccggatccccgaacgctttttccctggcaaa
tgtgacatctggtttcactctcatcagctgtttcatatctttgtggttgctggagctttt
gttcacttccatggtgtctcaaacctccaggagtttcgtttcatgatcggcgggggctgc
agtgaagaggatgcactgtga

DBGET integrated database retrieval system