KEGG   Homo sapiens (human): 79611Help
Entry
79611             CDS       T01001                                 

Gene name
ACSS3
Definition
acyl-CoA synthetase short-chain family member 3 (EC:6.2.1.1)
Orthology
K01908  
propionyl-CoA synthetase [EC:6.2.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q21.31
AA seq 686 aa AA seqDB search
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGS
EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRH
IENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQ
AMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEE
ALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTS
GTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGN
TTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKT
LFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVP
GYNVMILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDA
GYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLA
LCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVN
GKPYKITSTIEDPSIFGHVEEMLKQA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgtcttggctgcagtgtcgtaaagtcaccagcgccggggggctcggagggccc
ttgcctgggtcctctccggcccggggagccggtgcggccctcagggctttagtggtcccg
ggcccgcggggcggtctcgggggccggggatgcagggcactgtcctccggcagtggcagc
gagtacaagacccacttcgcagcctcggtgaccgaccccgagaggttctggggcaaagct
gccgagcagatcagctggtacaagccctggaccaaaacgctggagaacaaacactcgccc
tctaccaggtggtttgtggaaggaatgcttaacatttgttacaatgccgttgatcgtcat
attgaaaatggtaaaggggataagattgctatcatctatgacagtcctgttacaaacact
aaagcaacctttacctataaagaagttctggagcaggtctccaagctggctggtgtcttg
gtcaagcatggcatcaagaaaggtgacactgtggttatctacatgcctatgatcccacag
gcgatgtataccatgttggcatgtgcaaggataggtgccatccacagtctcatatttgga
ggatttgcttccaaagaactaagtagtcgcattgatcatgtaaagcccaaggtggttgtt
acagcatcatttggcattgaacctggaaggagggtagagtacgtaccacttgtagaagaa
gcgctaaaaataggacaacacaaaccagacaaaattctcatttataatcgtccaaatatg
gaggcggttcctttggctcccggtcgtgaccttgattgggatgaagagatggcaaaagcc
cagtcacatgactgtgttcctgttctttcagaacacccactgtatattctttacacatct
ggcacaacggggttacctaagggtgtgattaggcccactgggggatacgctgtcatgcta
cactggtcaatgtcttccatatacggacttcaacccggagaggtgtggtgggcagcttct
gacttaggctgggttgttggacattcctatatctgctatggacctcttcttcatgggaac
acaacagttttatatgaggggaagcctgtgggaacaccagatgctggcgcttatttccgt
gtgcttgcagagcatggagtagctgccttgtttacagcaccaactgcaattagagcaatc
cgtcaacaggaccctggggcagctttggggaagcagtactctctgacaaggttcaaaaca
ttatttgtggctggagaacgatgtgatgtagagaccctggaatggtccaaaaatgtcttc
agagtacctgtcttagaccattggtggcaaactgagactggatctccaattactgcgtca
tgtgttggattaggcaattctaaaacacctccaccagggcaagcaggaaaaagcgtccca
ggatacaatgttatgattttggatgacaacatgcaaaaactgaaggctcggtgtttagga
aatattgtggtaaagttaccattgccacctggggctttttcaggactctggaagaatcag
gaagcattcaagcatttatactttgaaaaatttcctggatattatgataccatggatgct
ggttacatggatgaagaaggctatttgtatgttatgtctcgagtggatgatgtaataaat
gttgcaggtcacagaatttctgcaggcgccattgaagagtcaatcctttcccatggtacc
gtggcagactgtgctgttgttggcaaggaagatcccttaaaaggtcatgtccccttagca
ctctgtgtattgagaaaagatataaatgcaacagaggagcaagttttggaagaaattgtg
aaacacgttagacagaacattggccctgtggctgcttttcgaaatgcagtgtttgtcaaa
cagctacccaaaaccagatctggcaagatcccccgatcagctttatctgccattgtcaat
ggcaagccatacaagataacttctacaattgaagaccccagcatttttggccacgtagaa
gaaatgctgaagcaagcataa

DBGET integrated database retrieval system