KEGG   Homo sapiens (human): 79621Help
Entry
79621             CDS       T01001                                 

Gene name
RNASEH2B, AGS2, DLEU8
Definition
ribonuclease H2, subunit B
Orthology
K10744  
ribonuclease H2 subunit B
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Disease
H00290  
Aicardi-Goutieres Syndrome (AGS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    79621 (RNASEH2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q14.3
AA seq 257 aa AA seqDB search
MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQL
FEVKVFKEKHHSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDN
VFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKT
NNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAHGLISDYIPKELSDDLSKYLKLPEPSAS
LPNPPSKMAAQRQKRGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccgctggcgtggactgcggggacggggttggcgcccggcagcacgtgttcctggtt
tcagaatatttaaaagatgcttcaaagaagatgaaaaatgggctaatgtttgtaaaactg
gttaacccctgttcaggagaaggagccatttacttgttcaatatgtgtctacagcagctg
tttgaagtaaaagttttcaaggaaaaacaccattcttggtttataaatcaatcagttcaa
tcaggaggtcttctccattttgccacacctgtggatcctctatttctgcttctccactac
ctcataaaggctgataaggaggggaagtttcagccccttgatcaagttgtggtggataac
gtgtttccaaattgcatcttgttgctgaaacttcctggacttgagaagttacttcatcat
gtgacagaggaaaaaggtaatccagaaatagacaacaagaaatattacaagtacagcaaa
gagaagacattaaagtggctggaaaaaaaggttaatcaaactgtggcagcattaaaaacc
aataatgtgaatgtcagttcccgggtacagtcaactgcatttttctctggtgaccaagct
tccactgacaaggaagaggattatattcgttatgcccatggtctgatatctgactacatc
cctaaagaattaagtgatgacttatctaaatacttaaagcttccagaaccttcagcctca
ttgccaaatcctccatcaaagatggcagcacaaagacagaaaaggggcaagtga

DBGET integrated database retrieval system