KEGG   Homo sapiens (human): 79621Help
Entry
79621             CDS       T01001                                 

Gene name
RNASEH2B, AGS2, DLEU8
Definition
(RefSeq) ribonuclease H2 subunit B
  KO
K10744  ribonuclease H2 subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Disease
H00290  Aicardi-Goutieres syndrome (AGS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    79621 (RNASEH2B)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RNase H
    79621 (RNASEH2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNase_H2-Ydr279
Motif
Other DBs
NCBI-GeneID: 79621
NCBI-ProteinID: NP_078846
OMIM: 610326
HGNC: 25671
Ensembl: ENSG00000136104
Vega: OTTHUMG00000016937
Pharos: Q5TBB1(Tbio)
UniProt: Q5TBB1 Q8N451
Structure
PDB: 

Jmol
Position
13q14.3
AA seq 312 aa AA seqDB search
MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQL
FEVKVFKEKHHSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDN
VFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKT
NNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAHGLISDYIPKELSDDLSKYLKLPEPSAS
LPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSKMTAAQKALAKVDKSGMKSIDTF
FGVKNKKKIGKV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggccgctggcgtggactgcggggacggggttggcgcccggcagcacgtgttcctggtt
tcagaatatttaaaagatgcttcaaagaagatgaaaaatgggctaatgtttgtaaaactg
gttaacccctgttcaggagaaggagccatttacttgttcaatatgtgtctacagcagctg
tttgaagtaaaagttttcaaggaaaaacaccattcttggtttataaatcaatcagttcaa
tcaggaggtcttctccattttgccacacctgtggatcctctatttctgcttctccactac
ctcataaaggctgataaggaggggaagtttcagccccttgatcaagttgtggtggataac
gtgtttccaaattgcatcttgttgctgaaacttcctggacttgagaagttacttcatcat
gtgacagaggaaaaaggtaatccagaaatagacaacaagaaatattacaagtacagcaaa
gagaagacattaaagtggctggaaaaaaaggttaatcaaactgtggcagcattaaaaacc
aataatgtgaatgtcagttcccgggtacagtcaactgcatttttctctggtgaccaagct
tccactgacaaggaagaggattatattcgttatgcccatggtctgatatctgactacatc
cctaaagaattaagtgatgacttatctaaatacttaaagcttccagaaccttcagcctca
ttgccaaatcctccatcaaagaaaataaagttatcagatgagcctgtagaagcaaaagaa
gattacactaagtttaatactaaagatttgaagactgaaaagaaaaatagcaaaatgact
gcagctcagaaggctttggctaaagttgacaagagtggaatgaaaagtattgataccttt
tttggggtaaaaaataaaaaaaaaattggaaaggtttga

DBGET integrated database retrieval system