KEGG   Homo sapiens (human): 79631Help
Entry
79631             CDS       T01001                                 

Gene name
EFL1, EFTUD1, FAM42A, HsT19294, RIA1
Definition
(RefSeq) elongation factor like GTPase 1
  KO
K14536  
ribosome assembly protein 1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    79631 (EFL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     79631 (EFL1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   GTPases
    79631 (EFL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q7Z2Z2(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
15q25.2
AA seq 1120 aa AA seqDB search
MVLNSLDKMIQLQKNTANIRNICVLAHVDHGKTTLADCLISSNGIISSRLAGKLRYMDSR
EDEQIRGITMKSSAISLHYATGNEEYLINLIDSPGHVDFSSEVSTAVRICDGCIIVVDAV
EGVCPQTQAVLRQAWLENIRPVLVINKIDRLIVELKFTPQEAYSHLKNILEQINALTGTL
FTSKVLEERAERETESQVNPNSEQGEQVYDWSTGLEDTDDSHLYFSPEQGNVVFTSAIDG
WGFGIEHFARIYSQKIGIKKEVLMKTLWGDYYINMKAKKIMKGDQAKGKKPLFVQLILEN
IWSLYDAVLKKDKDKIDKIVTSLGLKIGAREARHSDPKVQINAICSQWLPISHAVLAMVC
QKLPSPLDITAERVERLMCTGSQTFDSFPPETQALKAAFMKCGSEDTAPVIIFVSKMFAV
DAKALPQNKPRPLTQEEIAQRRERARQRHAEKLAAAQGQAPLEPTQDGSAIETCPKGEEP
RGDEQQVESMTPKPVLQEENNQESFIAFARVFSGVARRGKKIFVLGPKYSPLEFLRRVPL
GFSAPPDGLPQVPHMAYCALENLYLLMGRELEYLEEVPPGNVLGIGGLQDFVLKSATLCS
LPSCPPFIPLNFEATPIVRVAVEPKHPSEMPQLVKGMKLLNQADPCVQILIQETGEHVLV
TAGEVHLQRCLDDLKERFAKIHISVSEPIIPFRETITKPPKVDMVNEEIGKQQKVAVIHQ
MKEDQSKIPEGIQVDSDGLITITTPNKLATLSVRAMPLPEEVTQILEENSDLIRSMEQLT
SSLNEGENTHMIHQKTQEKIWEFKGKLEQHLTGRRWRNIVDQIWSFGPRKCGPNILVNKS
EDFQNSVWTGPADKASKEASRYRDLGNSIVSGFQLATLSGPMCEEPLMGVCFVLEKWDLS
KFEEQGASDLAKEGQEENETCSGGNENQELQDGCSEAFEKRTSQKGESPLTDCYGPFSGQ
LIATMKEACRYALQVKPQRLMAAMYTCDIMATGDVLGRVYAVLSKREGRVLQEEMKEGTD
MFIIKAVLPVAESFGFADEIRKRTSGLASPQLVFSHWEIIPSDPFWVPTTEEEYLHFGEK
ADSENQARKYMNAVRKRKGLYVEEKIVEHAEKQRTLSKNK
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcaacagtttggataagatgattcaactccagaaaaacactgccaacatcagg
aatatttgtgttttggctcatgttgaccatggaaaaactactctggctgactgtcttata
tctagcaatggaatcatctccagccgcctagcaggcaagttaaggtacatggacagcaga
gaagatgaacagatccgagggatcactatgaaatccagtgccatttccctacattatgca
acaggtaatgaggagtacctgatcaatctgatagactctccaggacacgtggacttttcc
tcagaagtatcaaccgctgttcgcatttgtgatggatgcatcattgtggtagatgctgtg
gaaggagtctgtccacagacacaggcagttctgcgacaagcttggcttgaaaacatccgt
ccggttttagtgattaataagattgatcgcttgatagtggaactgaaattcaccccacaa
gaggcctattctcacctcaagaatattttagaacagattaatgcgctcacagggactctt
tttacttctaaagtcctagaagaaagagcagagagggagactgaatcccaagtgaatcca
aattctgaacaaggagagcaagtatatgactggagcactggcttggaggacacagatgat
tctcacctttacttctctccagaacagggaaatgtggtgtttaccagtgcaatagatggg
tggggctttggaattgagcacttcgccagaatctacagtcaaaaaattggcatcaaaaag
gaagttcttatgaaaaccttgtggggagattactatataaatatgaaggctaaaaagatc
atgaagggtgatcaggccaaaggaaagaaacctttatttgtacagttgatcctggaaaat
atatggagtttgtatgatgctgttttgaaaaaggacaaagacaaaattgataaaatagtg
acttctttaggattaaaaattggagcccgggaggcacgacattcagaccctaaagttcag
atcaacgccatttgcagtcagtggctacccatatcccatgctgttcttgctatggtgtgt
cagaaacttcctagtccccttgatattacagctgagagagtggagagactgatgtgcaca
ggatcacaaacttttgactcttttccaccagaaactcaagcactgaaagcagcttttatg
aaatgtggaagtgaggacactgctccagttattatatttgtttccaaaatgtttgcagtt
gatgctaaggccttgcctcagaataagccaaggcctctcactcaagaagaaattgctcag
agacgtgagcgtgcaagacaaaggcatgcagagaagcttgcagcagcacagggacaggca
cccttggagcccacccaagatgggagtgccattgaaacatgtccaaaaggagaggagcca
agaggtgacgagcaacaggtggaaagtatgacccctaaacctgtgctccaggaagaaaac
aaccaagagtcttttattgcatttgctcgggtgttcagtggtgtggctcgaagaggaaag
aaaatttttgtcttggggcccaaatacagtcctcttgagtttttacgaagggtaccatta
ggcttctcagctccaccagatggcctcccccaagtcccccacatggcatactgtgctctg
gaaaacctgtatcttctgatgggaagggaactggaatatctagaggaggtacctccagga
aatgtgctaggaataggaggccttcaagattttgtgctgaaatctgcaacactgtgtagc
ctgccatcctgcccaccatttataccactcaacttcgaagccactcctattgtgagagtt
gctgttgaaccaaaacatccaagtgaaatgcctcagctcgtaaaaggaatgaaactgtta
aaccaggctgatccctgtgtccagattttaattcaggaaacgggagagcacgttttagtc
acagcaggagaagtccaccttcagcgatgcctggatgacttaaaagaaaggtttgcaaag
attcatatcagtgtatctgaacctattattccattcagagaaacaatcacaaaaccccca
aaagttgacatggtcaatgaagaaataggcaaacagcaaaaagttgcagtcatacaccaa
atgaaagaagatcaaagcaaaatccctgaaggaatccaagttgactctgacgggctaatc
accataacaactcccaataaacttgccacgctcagtgttcgagccatgccccttccagaa
gaagtcacccagattctggaagaaaatagtgatttgattcgttctatggagcagttgaca
tcctctttgaatgagggtgaaaatactcacatgattcatcagaagacccaagagaaaatt
tgggaattcaaaggaaaactggagcaacacctaacagggagaagatggaggaacattgtt
gaccaaatctggtcatttggcccaagaaaatgtgggcccaacatactagtcaataaaagt
gaagattttcagaactcagtatggacaggtccagctgacaaagcttcaaaagaagccagt
agataccgagatttgggcaatagcattgtgagtggcttccaactagcaaccctctctggc
cccatgtgtgaggagcctctcatgggtgtctgttttgttctggaaaaatgggacctaagt
aaatttgaggaacaaggagcaagtgatctggcaaaagagggacaggaggaaaatgaaacc
tgttctggtggaaatgaaaaccaagagctacaagatggctgctctgaggcctttgagaag
aggacatcacagaaaggagaatctccactcactgactgctatggacctttctcaggacag
ctaattgccaccatgaaagaagcatgtcgctatgcactgcaagtgaaacctcagcgcctg
atggcagctatgtacacatgtgacatcatggccactggtgatgttctcggtcgagtctat
gctgtcttgtcaaagagagaaggtcgggtacttcaagaagaaatgaaagaagggacagac
atgttcatcatcaaggctgtgctgcctgttgctgaaagctttggttttgctgatgaaatc
aggaagaggacaagtggcctggccagcccacaactagtattcagccattgggagatcatt
cccagtgaccccttctgggtgccaactactgaggaggaatacttgcactttggggagaag
gctgactctgagaaccaagcccggaagtacatgaacgcagtacgaaagcggaaggggctt
tatgtggaagaaaagattgtggagcatgcagaaaagcagaggacactcagcaaaaataag
tag

DBGET integrated database retrieval system