KEGG   Homo sapiens (human): 79650Help
Entry
79650             CDS       T01001                                 

Gene name
USB1, C16orf57, HVSL1, Mpn1, PN, hUsb1
Definition
U6 snRNA biogenesis 1
Organism
hsa  Homo sapiens (human)
Disease
H00793  
Poikiloderma with neutropenia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q21
AA seq 247 aa AA seqDB search
MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGP
EDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFH
LSLSQSVVLRHHWILPFVQALKARMTSFHRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNL
TTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNK
FFSMPLK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcgcccctggtgggctacagcagcagcggctccgaggatgagtccgaggac
gggatgcggaccaggccgggggatgggagccaccgtcgtggccagagcccccttcccagg
cagagatttccagtacctgacagtgtgctgaacatgttcccgggcaccgaggaggggcct
gaagatgacagcacaaaacacgggggacgggtgcgcaccttcccccacgagcgaggcaac
tgggccacccacgtctatgtaccatatgaagccaaggaggagttcctggatctgcttgat
gtgttgctgccccatgcccagacatatgtcccccggctggtaaggatgaaggtgttccac
ctcagcctgtcccagagtgtggttctgcgccaccactggatcctccccttcgtgcaggct
ctgaaagcccgtatgacctccttccacaggacctttattgggcttgaggtcacttcaggg
catgcccagttcctggacctggtttcagaggtggacagagtcatggaggaattcaacctc
accactttctaccaggatccttctttccacctcagcctggcctggtgtgtgggtgatgca
cgtctccagctggaggggcagtgcctgcaggaactacaggcaatcgtggatgggtttgaa
gatgctgaggtgctgctgcgcgtgcacactgagcaagtccgctgcaagtctgggaacaag
ttcttctcgatgcctttgaagtga

DBGET integrated database retrieval system