KEGG   Homo sapiens (human): 79658Help
Entry
79658             CDS       T01001                                 

Gene name
ARHGAP10, GRAF2, PS-GAP, PSGAP
Definition
Rho GTPase activating protein 10
Orthology
K13736  
Rho GTPase-activating protein 10
Organism
hsa  Homo sapiens (human)
Pathway
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    79658 (ARHGAP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q31.23
AA seq 786 aa AA seqDB search
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKF
AHSLRDFKFEFIGDAVTDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCMYRKAAKKF
NMIPFEHRSGGKLGDGEVFFLKECTKRHTDSIDRRFCFDIEAADRPGVSLTMQAFSEEER
KQWLEALGGKEALSHSFNTAIIPRPEGNAQLDKMGFTIIRKCISAVETRGINDQGLYRVV
GVSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGDFI
VPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGP
TLMRPQEETVAALMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSASPPNAPPRQS
KRQGQRTKRPVAVYNLCLELEDGDNPYPSKEDTPTSSLDSLSSPSPVTTAVPGPPGPDKN
HLLADGGSFGDWASTIPGQTRSSMVQWLNPQSPTTTSSNSAVTPLSPGSSPFPFSPPATV
ADKPPESIRSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQ
NYVKLL
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcagcccctggagttcagcgactgctacctcgacagcccgtggttccgggag
aggatccgcgctcacgaagcggaactcgagaggaccaacaagttcatcaaagagctcatt
aaggacgggaagaacctcatcgctgcgacgaaaagtctgtcagtggcccagcggaagttt
gctcattcactcagagactttaagtttgagtttatcggtgatgctgtgacagatgatgaa
cgatgcatagatgcttccttacgtgaattttcaaattttttgaagaatctggaggaacag
agagaaattatggcattaagtgtaactgaaaccctgattaaacccttggaaaaattcaga
aaagagcaacttggagctgtaaaggaagaaaaaaagaagtttgacaaagagacagaaaag
aattatagtctaattgataaacatttgaatttatcagcaaaaaagaaagactcacattta
caagaggcagatatccaagtagagcagaaccggcaacacttctatgaactgtctctcgag
tatgtgtgtaagctgcaggaaatccaagaaagaaagaagtttgagtttgtggaacctatg
ctgtcattttttcaggggatgtttaccttctatcatcagggccatgaacttgccaaagac
ttcaatcactacaaaatggaactacagatcaacattcagaatacacggaatcgatttgaa
ggaacaaggtcagaagtggaagagctcatgaacaaaatcagacagaatcccaaggaccac
aaacgagcaagtcagtttacagccgaaggctacctgtatgtccaggaaaaaaggcctgct
ccgtttggttccagttgggtcaaacactattgcatgtatcgaaaagcagcaaagaagttc
aacatgatcccatttgagcacagatctggagggaaacttggggacggagaggtgttcttt
ttgaaagaatgtaccaagaggcatactgactccattgacagaaggttttgttttgacata
gaagctgctgatcggcctggcgtttccttgaccatgcaggcattttccgaagaggaaagg
aagcagtggttggaagctctgggtggaaaggaagctctgtcccatagttttaatacagcc
atcatcccaagaccagaaggaaatgcacagttggataagatggggttcacaattatcaga
aaatgcatcagtgccgttgaaacacgaggtataaatgaccaaggattgtacagagttgtg
ggggtgagttcaaaggtccagagacttctgagtatgttgatggatgtaaaaacatgcaat
gaggtggacctggagaattctgcagattgggaagtgaagacaataacaagtgccttgaaa
cagtatttgaggagtcttccagagcctctcatgacctatgagttacatggagatttcatt
gttccagccaaaagcggcagcccagaatctcgtgttaatgcgatccatttcttggtacac
aaactgccagagaagaataaagagatgttggatattttggtgaaacacttaacaaatgtt
tcaaatcactccaagcagaacctgatgactgtggcaaacttaggagtggtgtttggacca
actctgatgaggccacaggaagaaactgtcgctgccctcatggacttgaagtttcagaat
attgttgtggaaatcttaattgaaaaccatgaaaagatttttcggacgccgcccgatact
acattccctgagcccacctgcctgtcagcatcacccccaaatgcgccaccaaggcagtcg
aagagacaaggccagagaaccaagaggcccgtggccgtctacaatctttgtctggagctg
gaagatggtgacaatccttacccttccaaggaggacacccctaccagcagtctggactca
ctttcctccccgtctcccgtgactacagctgtccctgggcctcctggaccagacaaaaac
caccttctggcagatggagggagctttggagactgggcatccactatcccaggccagacc
cgatcgtctatggtccagtggcttaacccacagtctccaaccacaacaagctccaactca
gctgtgacacctctttcacccgggtcgtcccctttccccttttctcctcctgctactgta
gcggacaagccacctgaaagcatccgcagtcggaaggctcgagccgtgtatccgtgtgaa
gcagaacacagctcggaattatcttttgaaataggagcaatttttgaggatgtacaaacc
tccagggaacctggctggctagaagggactctgaacggcaagagggggctgattccacag
aactacgtcaagctgctgtag

DBGET integrated database retrieval system