KEGG   Homo sapiens (human): 79659Help
Entry
79659             CDS       T01001                                 

Gene name
DYNC2H1, ATD3, DHC1b, DHC2, DNCH2, DYH1B, SRPS2B, SRTD3, hdhc11
Definition
(RefSeq) dynein cytoplasmic 2 heavy chain 1
  KO
K10414  
dynein heavy chain 2, cytosolic
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Vasopressin-regulated water reabsorption
Salmonella infection
Disease
H00511  
Short rib-polydactyly syndrome
H00751  
Asphyxiating thoracic dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    79659 (DYNC2H1)
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    79659 (DYNC2H1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    79659 (DYNC2H1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      79659 (DYNC2H1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     79659 (DYNC2H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NCM8(Tbio)
UniProt: 
Position
11q22.3
AA seq 4307 aa AA seqDB search
MANGTADVRKLFIFTTTQNYFGLMSELWDQPLLCNCLEINNFLDDGNQMLLRVQRSDAGI
SFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPML
LKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWI
EQAHRGNKQISKERANYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWRQTEH
DHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDPYYLVKESLKAGISICEQWVIVCNH
LTGQVWQRYVPHPWKNEKYFPETLDKLGKRLEEVLAIRTIHEKFLYFLPASEEKIICLTR
VFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDSPQQLLQA
FLKYKELVKRPTISKELMLERETLLARLVDSIKDFRLDFENRCRGIPGDASGPLSGKNLS
EVVNSIVWVRQLELKVDDTIKIAEALLSDLPGFRCFHQSAKDLLDQLKLYEQEQFDDWSR
DIQSGLSDSRSGLCIEASSRIMELDSNDGLLKVHYSDRLVILLREVRQLSALGFVIPAKI
QQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGK
SQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKD
GLQELRTGLATVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLT
YKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEAGDESIFSIMIDRNASGFLTIF
SKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLP
SAVKVDCLNINCNPVKTVIDDLIQKLFDLLVLSLKKSIQAHLHEIDTFVTEAMEVLTIMP
QSVEEIGDANLQYSKLQERKPEILPLFQEAEDKNRLLRTVAGGGLETISNLKAKWDKFEL
MMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPGDDVIETGQHNTLDKSA
KLIKEKKIEFDDLEVTRKKLVDDCHHFRLEEPNFSLASSISKDIESCAQIWAFYEEFQQG
FQEMANEDWITFRTKTYLFEEFLMNWHDRLRKVEEHSVMTVKLQSEVDKYKIVIPILKYV
RGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKAADLKDLNSRAQGEVTI
REALRELDLWGVGAVFTLIDYEDSQSRTMKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNRVDEDFRSIMT
DIKKDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEI
LGQSTNPSVIQSHLKKLFAGINSVCFDEKSKHITAMKSLEGEVVPFKNKVPLSNNVETWL
NDLALEMKKTLEQLLKECVTTGRSSQGAVDPSLFPSQILCLAEQIKFTEDVENAIKDHSL
HQIETQLVNKLEQYTNIDTSSEDPGNTESGILELKLKALILDIIHNIDVVKQLNQIQVHT
TEDWAWKKQLRFYMKSDHTCCVQMVDSEFQYTYEYQGNASKLVYTPLTDKCYLTLTQAMK
MGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCF
DEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEVNSNSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSHPDNELIAEVILYSEGFKDAKVLSRKLVAIFNLSRELLTPQQ
HYDWGLRALKTVLRGSGNLLRQLNKSGTTQNANESHIVVQALRLNTMSKFTFTDCTRFDA
LIKDVFPGIELKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLCQRMGVVIVGP
SGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLGHIDMDTREWSDGVLTNSARQ
VVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLS
CASPATISRMGMIFLSDEETDLNSLIKSWLRNQPAEYRNNLENWIGDYFEKALQWVLKQN
DYVVETSLVGTVMNGLSHLHGCRDHDEFIINLIRGLGGNLNMKSRLEFTKEVFHWARESP
PDFHKPMDTYYDSTRGRLATYVLKKPEDLTADDFSNGLTLPVIQTPDMQRGLDYFKPWLS
SDTKQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVIST
NTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENI
QIVASMSAGGRLGRHKLTTRFTSIVRLCSIDYPEREQLQTIYGAYLEPVLHKNLKNHSIW
GSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPL
DYVLEIVAYEARRLFRDKIVGAKELHLFDIILTSVFQGDWGSDILDNMSDSFYVTWGARH
NSGARAAPGQPLPPHGKPLGKLNSTDLKDVIKKGLIHYGRDNQNLDILLFHEVLEYMSRI
DRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLQL
AGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGF
FGPVFNYFTYRIQQNLHIVLIMDSANSNFMINCESNPALHKKCQVLWMEGWSNSSMKKIP
EMLFSETGGGEKYNDKKRKEEKKKNSVDPDFLKSFLLIHESCKAYGATPSRYMTFLHVYS
AISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQMIT
VSMQDASEQKTELERLKHRIAEEVVKIEERKNKIDDELKEVQPLVNEAKLAVGNIKPESL
SEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNISKEIR
ESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANIQYSHVLERIHPLETEQAGLESNL
KKTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLINQLD
REHKRWNAQVVEITEELATLPKRAQLAAAFITYLSAAPESLRKTCLEEWTKSAGLEKFDL
RRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSRL
EVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKII
DYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKT
KLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQESLKESYK
LQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLAAFLRLFQRALQNKQDSENT
EQRIQSLISSLQHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDM
LRKADSQQKIRDQLPSWIDQERSWAVATLKIALPSLYQTLCFEDAALWRTYYNNSMCEQE
FPSILAKKVSLFQQILVVQALRPDRLQSAMALFACKTLGLKEVSPLPLNLKRLYKETLEI
EPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLAIQMLKECARNGDWLCLK
NLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNL
MRTYESWTPEQISKKDNTHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGY
NIIDRLFDGAKDVQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSVIDVFNQRN
KKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRI
LGRSITAGSKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVPPPNDRQGSPILSFIILEQ
FNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLAWQSKWEGPEDPLQY
LRGLVARALAIQNWVDKAEKQALLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKF
VASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDACGP
YSPDECISLPVYTSAERDRVVTNIDVPCGGNQDQWIQCGAALFLKNQ
NT seq 12924 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgggactgcggacgttcggaagctcttcatcttcactactacccagaattac
ttcgggttgatgtctgaactctgggatcagccactgttgtgcaactgtcttgaaatcaac
aacttcttggatgacggcaaccagatgctcctcagggtgcagcgatccgacgcaggaatc
tccttttccaacacgattgagtttggtgacacaaaagataaagtgctggtgtttttcaag
ctgcgacctgaagtaattactgatgagaatctacatgataacattcttgtttcatctatg
ttagagtcacctattagttctctttaccaagcagtacggcaagtattcgcaccaatgttg
ttaaaggatcaggaatggagcagaaactttgatcccaaacttcagaatcttttgagtgaa
ctagaagctgggttgggtatagttctacgaagatcagacactaacttaacaaaattgaaa
tttaaggaagatgacacacgaggtatccttacaccaagcgatgagttccagttttggata
gaacaagctcaccgtggaaataaacagattagtaaagaaagagccaattattttaaagaa
ttatttgaaacaattgcaagagagttttataacttggacagtctatccttactagaagtt
gttgacttggtggagactactcaggatgttgtagatgatgtgtggagacaaacagaacat
gatcattatcctgagtcacgaatgttgcatctcttagacatcataggtggttcatttgga
aggtttgttcagaaaaagttgggaactttgaacctgtgggaagatccttattatcttgtg
aaagaaagtctgaaagctggtatttcaatttgtgaacagtgggtgatagtctgtaatcat
ctaacaggtcaggtgtggcagcgctatgttcctcatccatggaaaaatgaaaaatatttt
ccagaaacacttgacaaacttggcaaacgccttgaagaggtcttggctattagaacaatt
catgagaagtttctctattttctacctgccagtgaagagaaaatcatatgcctcactcga
gtatttgaaccttttactggcctgaatcctgtgcaatataatccatatactgagcccttg
tggaaagctgcggtgtctcaatatgaaaagattattgcacctgcggaacaaaaaatagca
ggaaaattgaaaaattatatttcagaaattcaagacagtccacagcagcttcttcaagca
ttcctgaaatataaagagttggtaaagcgtccaactataagcaaagaattgatgttagaa
agagaaactttactggcaagacttgtggactcaattaaagattttcgattagactttgag
aatcggtgccgaggaattcctggtgatgcatctggaccactttctggcaaaaatctttca
gaagttgtcaacagtatagtttgggttcgccagttggaattgaaggtagatgatactatc
aagattgcagaggctcttttatctgacttgccaggatttcgatgtttccatcaaagtgcc
aaagatctcttagaccagcttaaactatatgaacaggaacaatttgatgattggtccagg
gatattcaatcaggtttatctgattccagatctggtttgtgtattgaggctagtagtcga
attatggaattggattctaatgatggattactaaaagtgcattattcagatcgtttggtg
attcttctgagagaagttcgtcagctctctgcacttggctttgttattcctgccaaaata
cagcaagttgcaaacattgcacagaaattctgcaagcaagcaattattcttaaacaagtg
gcacatttttataattctattgatcaacaaatgattcaaagtcagaggccaatgatgtta
caatctgccttagcatttgaacagataattaagaattcaaaagcaggaagtggagggaaa
tcacagataacttgggataatcctaaagaattagaaggctatatccaaaaactccaaaat
gctgctgaacggcttgccactgaaaatagaaaactgagaaaatggcacactacattttgt
gaaaaggtggttgttcttatgaatattgatctgcttcggcagcaacagcgctggaaagat
ggattacaagaattgagaactggcttagcaactgtagaagcacagggattccaagcaagt
gacatgcatgcatggaaacaacactggaatcatcaactgtacaaagctctggagcatcag
taccagatgggcttagaagcacttaatgagaatttgccagaaataaatatagacttaact
tacaaacagggacgattacaattcaggcccccttttgaagaaatccgggctaaatattat
agagaaatgaagagattcatcggcattccaaatcagtttaagggagtgggtgaggcagga
gatgaatctattttttctattatgattgatagaaatgcaagtggatttttgacgattttc
agcaaagcagaagatctgtttagaagattgtcagctgttttacaccaacataaggaatgg
attgtaattgggcaagttgatatggaagctctggtggaaaagcatctttttactgtacat
gattgggagaaaaattttaaagcattaaaaataaaggggaaagaagtagaacgacttcca
agtgctgtcaaggtagattgtttaaatattaattgcaaccctgtgaagactgtgattgat
gatctcatccagaagttatttgatctgcttgttctttctttgaagaagtccatacaggct
catttacatgaaattgatacatttgttactgaggctatggaagtcttaacaattatgccc
cagtctgtggaagaaattggtgatgcaaatctacaatatagtaagttacaagaacggaag
ccagagattttgcccttatttcaagaagctgaagacaaaaacagacttttacgaactgtg
gctggtggaggtttagaaacaattagtaatttgaaagccaagtgggataaatttgagtta
atgatggaaagtcaccaacttatgattaaagaccagattgaagtgatgaaaggaaatgtg
aaatcacgtcttcagatctattatcaagaactggaaaaatttaaagctcgttgggaccaa
ctaaagcctggtgatgatgttattgaaactggccaacataatactcttgataaaagtgca
aagttaataaaagagaaaaaaattgagtttgatgatcttgaagtcacaagaaaaaagctg
gttgatgattgccatcattttagactggaagagcctaatttctccctggcaagtagtatc
tctaaagatatcgagagctgtgcccaaatttgggccttttatgaagagtttcaacaagga
tttcaggaaatggccaatgaagactggatcacttttcggactaagacatacctgtttgag
gaatttttgatgaactggcatgacagattaaggaaggttgaagaacattcagtgatgaca
gtgaaattacaatcagaggttgacaaatataaaatcgtaattcctatcttgaaatatgtg
agaggggagcatctttctccagatcactggcttgacctttttcgtctccttggacttcct
agggggactagtctagagaaactactgtttggtgatttgctcagagtagctgatacaatt
gtagccaaagctgccgaccttaaagatttaaatagtcgggcacaaggtgaagttacaatc
agagaagctttacgtgaacttgatctttggggagttggagcagtgtttacattaattgat
tatgaagacagccaaagtcgaactatgaagctgattaaagactggaaagatatagtaaat
caggttggagataatagatgccttctccaatccttaaaggattctccttattataaagga
tttgaagataaagtatcaatttgggaaagaaaacttgcagagttagatgaatacctgcag
aatttaaatcatattcagagaaagtgggtgtatttggaacccattttcggccgtggagca
ttgccaaaagaacagacacgcttcaacagagttgatgaagattttagatcaataatgact
gatatcaagaaagacaatagagtcacaacattaactactcatgctggaataagaaattct
ctactaacaatacttgatcagcttcaaagatgtcagaaatcattaaatgaatttttggag
gaaaaacgctcagcattcccaagattttattttattggtgatgatgacttattagaaata
ttgggccagtctaccaacccatcagtgattcagtctcacctgaagaagctttttgctggt
attaacagtgtttgctttgatgagaaatcaaaacatataactgcaatgaaatctttagag
ggagaagttgtaccttttaaaaataaagttcctctatcaaataatgtagagacatggttg
aatgatttggccttagaaatgaagaaaactttggaacagttgttgaaggaatgtgttact
actgggcgaagttctcaaggtgcagttgacccatctctgttcccttcacagattttatgc
ttggcggagcagattaaattcactgaagatgtagaaaatgctattaaagatcatagtctt
catcagattgaaacacaactggtgaataagttagagcaatatactaacattgatacaagt
tctgaggatccagggaatactgaatcgggcatcctggagcttaaacttaaagccctaatt
cttgacattatccataatattgatgtggtaaagcagttaaaccaaattcaggttcataca
actgaagactgggcttggaaaaaacaacttagattctatatgaaaagtgatcatacatgt
tgtgttcaaatggtggattctgaatttcagtatacttatgaatatcagggtaatgcttcc
aaactggtttatactccactgacagacaagtgctacttaactctcactcaagccatgaag
atgggacttggaggaaatccttatggaccagctggaactgggaaaacggaatcagtaaag
gctttaggtggacttcttggaagacaagttttagtctttaattgtgatgagggcatcgat
gtgaagtcaatgggacgaatatttgttggtttggtgaagtgtggggcctggggttgtttt
gatgaatttaataggctggaagaatctgtactgtcagcagtttctatgcaaatccagaca
attcaagatgctttgaagaatcatagaactgtatgtgaactgcttggcaaggaggtagaa
gtaaattctaattctggaatttttatcactatgaatcctgctggaaaaggttatggagga
agacaaaaactgcctgataatcttaaacagcttttcaggcccgtagctatgtctcatcca
gacaatgagcttattgcagaagttattctctattcggaaggctttaaagacgctaaagta
ttgagcagaaaattggtagctattttcaatctatctagggaacttttgacacctcagcaa
cattatgattggggtttgagagctttgaagacagttctgagaggaagtggaaatctcctt
agacagctaaacaaaagtggcactacacagaatgctaatgaaagtcatattgtggtacaa
gcactgaggcttaataccatgtcaaagtttacgtttactgattgcacccggtttgatgca
ctgataaaagatgtctttccgggaattgaattgaaagaagtggaatatgatgaactaagt
gctgcattaaagcaggtctttgaagaggccaattatgaaattatacccaatcagatcaaa
aaggctttagaattgtatgaacagttatgccagaggatgggagttgttattgttggtcca
agtggtgctggaaaatcaacgctttggagaatgttaagggctgcgctttgtaaaactggc
aaagtagtgaaacaatatactatgaatcccaaagctatgcctcgatatcaattattaggc
catattgacatggacacaagagaatggtctgatggtgttttgacaaatagtgctcgtcaa
gtggttcgggaacctcaagatgtcagctcatggataatctgtgatggtgatattgaccct
gaatggatagaatctctgaattctgttctggatgataatcgactgctgactatgcccagt
ggagaaaggattcagtttggcccaaatgttaactttgtatttgaaactcatgatttaagt
tgtgcatcaccagccacaatatctagaatgggaatgatctttcttagtgatgaagagaca
gatcttaattctctgataaaatcttggttgaggaatcagcctgctgaatatagaaataat
cttgaaaattggattggagattattttgaaaaggctttacaatgggttctaaagcagaat
gactatgtggtagaaacaagtttggttgggactgtgatgaatggtttgtcacatctacat
ggttgcagagatcatgacgaattcattattaatctcataaggggacttggtggaaatctg
aatatgaagtcacgtttggaatttaccaaagaggtttttcattgggcacgagaatctcct
ccagactttcacaaacctatggatacctactatgactctactaggggtcgattagcaaca
tatgtgcttaagaagccagaagacttgactgctgatgatttcagtaacggcttaactctt
ccagtcattcagactcctgacatgcaacgaggtctagattatttcaaaccatggttaagt
tctgatactaaacagccctttattctggtaggaccagaaggatgtggcaaagggatgctg
ctcaggtacgcattttcacaactccggtccactcaaattgctacagttcactgtagtgca
caaaccacttctcgacatctcctgcagaaactgagccagacttgcatggtaatcagtact
aatactggtcgtgtatacagaccaaaagactgtgaaagacttgttctgtacttaaaagat
atcaacctacctaaacttgataaatgggggaccagtactttggtagcattcctacaacag
gtattgacgtatcaaggattttatgatgaaaatttggaatgggttggtctagaaaatatt
caaattgtggcttctatgtcagctggaggaagactgggaagacataaacttactaccaga
tttacttccatcgttcgtctttgttctatagattacccagaaagagagcagttacaaacg
atttatggagcatatttggaaccagttctacataaaaatctgaagaatcattctatttgg
ggttcttcatcaaaaatttatcttttagcaggatctatggtacaagtgtatgaacaggtg
cgagccaaatttacagttgatgattatagtcactatttctttactccttgcattcttacc
caatgggttcttggcttatttagatatgatttagaaggaggatcctcaaaccatccacta
gattatgtgttagaaattgtagcatatgaggcacggcgcttatttcgtgacaaaattgtt
ggtgcaaaggaacttcatttatttgacatcattttaacatcagtgtttcaaggagattgg
ggctcagacatattagacaatatgtcagatagtttctacgttacatggggagctcggcat
aattcaggagcaagggcagccccaggacaaccattacctccacatggaaaaccacttgga
aaactaaactctactgatctcaaggatgttattaaaaagggtcttattcattatggacga
gataaccagaatttagacattttacttttccacgaagtcttggagtatatgtctaggata
gatagagtgctgagtttccctggaggttcacttctattagcaggacgcagtggtgtaggt
cgtcggaccatcacttctttagtcagtcacatgcatggagcggtcctgttttctccaaag
atttccagaggatatgaactgaagcagttcaaaaatgatctcaaacatgtgctgcaactt
gcaggaattgaagcacaacaggtagttttacttcttgaggattaccagtttgtacatcct
acatttttggagatgatcaatagccttttgtcttcaggtgaagttcctggactctatact
cttgaagaattagagcccttgctgttaccacttaaggatcaagcttcacaagatggtttt
tttggaccagtcttcaattacttcacatatagaattcagcaaaacttgcatattgtcttg
ataatggattctgcaaattcaaacttcatgataaactgtgagagtaatccagctttgcat
aagaaatgccaggtgttgtggatggagggttggtccaatagcagtatgaagaaaatacct
gaaatgttattcagtgaaacaggtggtggagaaaaatacaatgataaaaaacgaaaagaa
gaaaagaaaaaaaattcagttgatcctgattttctaaaatcatttttattaatccatgaa
tcttgtaaagcatatggtgctacaccaagccgatacatgacctttttacatgtgtattct
gccattagtagtagcaagaaaaaggaattattaaaaagacaaagtcatttgcaggctggt
gtatctaaactaaatgaagctaaagctcttgtggatgaactgaacagaaaagctggagaa
caaagtgtgttacttaaaacgaagcaagatgaagcagatgctgcccttcaaatgatcaca
gtgtcaatgcaggatgctagtgagcaaaaaacagaacttgaaagactgaagcacagaata
gcagaagaagttgttaaaattgaagaaagaaaaaataaaattgatgatgaattaaaagaa
gtacaacctttagtcaatgaagctaaactagcagttggaaacattaagcccgaatcactt
tcagaaattcgctcactacgcatgccacctgatgtaattagagatattcttgaaggagtt
ttaaggttgatgggtatctttgatacatcttgggtgagcatgaaaagtttccttgcaaaa
agaggtgtaagagaagacatagcaacctttgatgcccgaaatatttcaaaggaaataaga
gagagtgttgaagaacttctttttaaaaataaaggctcttttgatccaaagaatgctaag
cgtgccagtactgcagctgcacctttggctgcctgggtgaaagccaatattcagtattcc
catgtcttggaacgaattcatcctttggaaactgaacaggcaggattagaatcgaatctg
aagaaaactgaagacagaaaaaggaaactagaggagcttcttaattctgttggtcaaaag
gtatcagaactcaaagaaaaatttcagagcaggacttcagaagctgccaaacttgaggct
gaagtaagcaaggcacaagaaacaatcaaagctgcagaagtcttaattaatcagcttgac
agagaacataagagatggaatgcacaggttgtagagataacagaggaattagctactctt
cctaaaagagctcaacttgctgctgcatttattacatatctttctgctgctcctgaatct
ctgagaaaaacctgtttggaagaatggaccaagtcagctggtcttgagaaatttgatctg
aggagatttctttgtactgaaagtgagcagttaatttggaaaagtgaaggcctaccatca
gatgacctttccatagaaaatgctcttgtaatattacagagtcgagtgtgcccatttctt
atagatccttcttcccaagctacagagtggttaaaaacacatttgaaagactcacgttta
gaagttatcaatcagcaggatagtaactttatcacagctcttgaattagcagtacgtttt
gggaaaacccttattatacaagagatggatggtgtagaacctgttctttatccattattg
agacgagatctggttgctcaaggaccacgttatgtggtacaaataggtgacaaaattatt
gactacaatgaagaattccgcctctttttgtcaacaagaaacccaaatccttttattcca
ccggatgcagcttccattgttactgaggttaactttactacaacaagaagtggattacga
gggcagcttttagctttaaccattcagcatgagaaacctgatttagaagaacagaaaaca
aaactattacaacaggaagaagataagaaaatacagctagccaagctcgaagaatctctt
ctagagacacttgccacatctcaaggcaatattttggaaaataaggatttgattgagtct
ttgaatcagacaaaagcaagcagtgcacttattcaagagtcacttaaagaatcttacaaa
ctccaaatttcccttgatcaagaacgggatgcctatctccccctggctgagagtgccagc
aagatgtacttcattatttctgatttgtccaaaattaataacatgtaccgttttagtttg
gctgcttttctccgacttttccaacgagctctacaaaacaaacaggattctgaaaataca
gaacagagaatccagtcacttatcagctcattacaacatatggtatatgaatatatatgt
cgttgtctatttaaggctgatcagttgatgttcgctttgcattttgttcgaggcatgcat
cctgaactttttcaagaaaatgaatgggatacgtttacaggtgtggttgttggagacatg
ttacggaaagctgactctcaacaaaaaatacgtgatcagcttccgtcttggatagatcag
gaacgaagctgggccgtggcaacattaaagattgctctccccagtctttatcagaccctc
tgctttgaagatgcagctctgtggcgtacttattataataattcaatgtgtgagcaagag
tttccatctatccttgcaaagaaagtttccttatttcagcagattcttgtagtacaggcg
ctaagaccggacagattgcaaagtgccatggctctttttgcatgtaaaactctgggactg
aaagaggtgtccccactgcctctaaatctcaaacgtttatacaaagagacactggaaatt
gaacccatcttgataattatttctccgggtgctgatccttctcaggaacttcaagaacta
gctaatgctgaaagaagcggagagtgttatcaccaggttgccatgggtcaaggtcaagct
gatttagcaattcaaatgctaaaagaatgtgcccgcaatggagactggctctgtttgaag
aacttacatcttgtggtatcttggctgccagttctggaaaaggaattgaatactcttcaa
cctaaagatacctttcgtctttggctcactgcagaagttcatcccaactttactcctatt
ttactacagtcaagtctgaagataacatatgagtcacctccaggtttaaagaagaattta
atgcgtacttatgagtcttggactcctgagcaaattagcaaaaaagataatacacatcga
gctcatgctctcttcagtcttgcatggtttcatgctgcatgtcaagaaagaagaaactat
attcctcagggttggacaaagttttatgaattttctttatcagatcttcgggctgggtac
aacattattgacagactttttgatggtgccaaagatgtacaatgggaatttgtacatggt
ttacttgaaaatgctatttatggaggacgtatagacaactattttgaccttagagttctt
cagtcatacctgaagcagttttttaattcttcagttattgatgtattcaaccaaaggaac
aagaaaagcatttttccatattccgtatctctaccacaatcctgcagcattttggactat
cgtgctgtcattgagaaaattccagaggacgacaaacctagtttctttggtctgcctgcc
aatatcgctcgctcatctcagcgcatgatcagttctcaggttatttcacagttgaggatt
ttgggcagatccataacagctggttccaaatttgatagagaaatctggtctaatgaactt
tctcctgtcctcaatctctggaagaaactaaaccagaattcaaacctaatacatcagaaa
gtgcctcctcctaacgatcgacaaggatctccaatactgtcattcatcattcttgaacaa
tttaatgctattcgtttagtacaaagtgtccaccagtctcttgctgctctcagcaaagtc
atcagaggaactactttactgagttcagaagtacaaaaattggcaagtgctttattaaac
caaaagtgtcctctcgcatggcagagcaagtgggaaggcccagaagatcccttacaatac
ctgagaggtcttgttgcccgtgcccttgcaatacagaactgggtagataaagctgaaaaa
caggctcttctctctgaaacacttgacctatcagaacttttccatccagacacatttctt
aatgctcttcgccaggaaactgcaagggcagtgggtcgttctgtggatagccttaaattt
gtagcctcatggaaaggtcgactgcaagaagcaaagctacaaattaagatcagtggcttg
ttactagaaggatgtagttttgatggaaatcaactttctgaaaatcagcttgattctccc
agcgtgtcatcagtgctcccttgttttatgggctggattccacaggatgcatgtggtcca
tattctccggatgagtgcatctctttgcctgtttacacaagtgctgaaagggatcgtgtg
gttaccaatattgatgttccatgtgggggcaaccaagaccagtggattcagtgtggagca
gctctattcctaaaaaatcagtag

DBGET integrated database retrieval system