KEGG   Homo sapiens (human): 79660Help
Entry
79660             CDS       T01001                                 

Gene name
PPP1R3B, GL, PPP1R4, PTG
Definition
protein phosphatase 1, regulatory subunit 3B
Orthology
K07189  
protein phosphatase 1 regulatory subunit 3A/B/C/D/E
Organism
hsa  Homo sapiens (human)
Pathway
Insulin signaling pathway
Class
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p23.1
AA seq 285 aa AA seqDB search
MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVK
KRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSAD
YLDFRNRLQADHVCLENCVLKDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYV
KDTYAGSDRDTFSFDISLPEKIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKST
QGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgtggacatcgagtacagatacaactgcatggctccttccttgcgccaagag
aggtttgcctttaagatctcaccaaagcccagcaaaccactgaggccttgtattcagctg
agcagcaagaatgaagccagtggaatggtggccccggctgtccaggagaagaaggtgaaa
aagcgggtgtccttcgcagacaaccaggggctggccctgacaatggtcaaagtgttctcg
gaattcgatgacccgctagatatgccattcaacatcaccgagctcctagacaacattgtg
agcttgacgacagcagagagcgagagctttgttctggatttttcccagccctctgcagat
tacttagactttagaaatcgacttcaggccgaccacgtctgccttgagaactgtgtgctc
aaggacaaggccattgcaggcactgtgaaggttcagaacctcgcatttgagaagaccgtg
aaaataaggatgacgttcgacacctggaagagctacacagactttccttgtcagtacgtg
aaggacacttatgccggttcagacagggacacgttctccttcgacatcagcttgcccgag
aagattcagtcttatgaaagaatggagtttgctgtgtactacgagtgcaatggacagacg
tactgggacagcaacagaggcaagaactataggatcatccgggctgagttaaaatctacc
cagggaatgaccaagccccacagtggaccggatttgggaatatcctttgaccagttcgga
agccctcggtgttcctatggtctgtttccagagtggccaagttacttaggatatgaaaag
ctagggccctactactag

DBGET integrated database retrieval system