KEGG   Homo sapiens (human): 79671Help
Entry
79671             CDS       T01001                                 

Gene name
NLRX1, CLR11.3, DLNB26, NOD26, NOD5, NOD9
Definition
NLR family member X1
Orthology
K12653  
NLR family member X1
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Influenza A
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.3
AA seq 975 aa AA seqDB search
MRWGHHLPRASWGSGFRRALQRPDDRIPFLIHWSWPLQGERPFGPPRAFIRHHGSSVDSA
PPPGRHGRLFPSASATEAIQRHRRNLAEWFSRLPREERQFGPTFALDTVHVDPVIRESTP
DELLRPPAELALEHQPPQAGLPPLALSQLFNPDACGRRVQTVVLYGTVGTGKSTLVRKMV
LDWCYGRLPAFELLIPFSCEDLSSLGPAPASLCQLVAQRYTPLKEVLPLMAAAGSHLLFV
LHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQASILVTTRPSAIGRIPS
KYVGRYGEICGFSDTNLQKLYFQLRLNQPYCGYAVGGSGVSATPAQRDHLVQMLSRNLEG
HHQIAAACFLPSYCWLVCATLHFLHAPTPAGQTLTSIYTSFLRLNFSGETLDSTDPSNLS
LMAYAARTMGKLAYEGVSSRKTYFSEEDVCGCLEAGIRTEEEFQLLHIFRRDALRFFLAP
CVEPGRAGTFVFTVPAMQEYLAALYIVLGLRKTTLQKVGKEVAELVGRVGEDVSLVLGIM
AKLLPLRALPLLFNLIKVVPRVFGRMVGKSREAVAQAMVLEMFREEDYYNDDVLDQMGAS
ILGVEGPRRHPDEPPEDEVFELFPMFMGGLLSAHNRAVLAQLGCPIKNLDALENAQAIKK
KLGKLGRQVLPPSELLDHLFFHYEFQNQRFSAEVLSSLRQLNLAGVRMTPVKCTVVAAVL
GSGRHALDEVNLASCQLDPAGLRTLLPVFLRARKLGLQLNSLGPEACKDLRDLLLHDQCQ
ITTLRLSNNPLTAAGVAVLMEGLAGNTSVTHLSLLHTGLGDEGLELLAAQLDRNRQLQEL
NVAYNGAGDTAALALARAAREHPSLELLHLYFNELSSEGRQVLRDLGGAAEGGARVVVSL
TEGTAVSEYWSVILSEVQRNLNSWDRARVQRHLELLLRDLEDSRGATLNPWRKAQLLRVE
GEVRALLEQLGSSGS
NT seq 2928 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggggccaccatttgcccagggcctcttggggctctggttttagaagagcactc
cagcgaccagatgatcgtatccccttcctgatccactggagttggccccttcaaggggag
cgtccctttgggccccctagggcctttatacgccaccacggaagctcggtagatagcgct
cccccacccgggaggcatggacggctgttccccagcgcctctgcaactgaagctatacag
cggcaccgccggaacctggctgagtggttcagccggctgcccagggaggagcgccagttt
ggcccaacctttgccctagacacggtccacgttgaccctgtgatccgcgagagtacccct
gatgagctacttcgcccacccgcggagctggccctggagcatcagccaccccaggccggg
ctccccccactggccttgtctcagctctttaacccggatgcctgtgggcgccgggtgcag
acagtggtgctgtatgggacagtgggcacaggcaagagcacgctggtgcgcaagatggtt
ctggactggtgttatgggcggctgccggccttcgagctgctcatccccttctcctgtgag
gacctgtcatccctgggccctgccccagcctccctgtgccaacttgtggcccagcgctac
acgcccctgaaggaggttctgcccctgatggctgctgctgggtcccacctcctctttgtg
ctccatggcttagagcatctcaacctcgacttccggctggcaggcacgggactttgtagt
gacccggaggaaccgcaggaaccagctgctatcatcgtcaacctgctgcgcaaatacatg
ctgcctcaggccagcattctggtgaccactcggccctctgccattggccgtatccccagc
aagtacgtgggccgctatggtgagatctgcggtttctctgataccaacctgcagaagctc
tacttccagctccgcctcaaccagccgtactgcgggtatgccgttggcggttcaggtgtc
tctgccacaccagctcagcgtgaccacctggtgcagatgctctcccggaacctggagggg
caccaccagatagccgctgcctgcttcctgccgtcctattgctggctcgtttgtgccacc
ttgcacttcctgcatgcccccacgcctgctgggcagacccttacaagcatctataccagc
ttcctgcgcctcaacttcagcggggaaaccctggacagcactgacccctccaatttgtcc
ctgatggcctatgcagcccgaaccatgggcaagttggcctatgagggggtgtcctcccgc
aagacctacttctctgaagaggatgtctgtggctgcctggaggctggcatcaggacggag
gaggagtttcagctgctgcacatcttccgtcgggatgccctgaggtttttcctggcccca
tgtgtggagccagggcgtgcaggcaccttcgtgttcaccgtgcccgccatgcaggaatac
ctggctgccctctacattgtgctgggtttgcgcaagacgaccctgcaaaaggtgggcaag
gaagtggctgagctcgtgggccgtgttggggaggacgtcagcctggtactgggcatcatg
gccaagctgctgcctctgcgggctctgcctctgctcttcaacctgatcaaggtggttcca
cgagtgtttgggcgcatggtgggtaaaagccgggaggcggtggctcaggccatggtgctg
gagatgtttcgagaggaggactactacaacgatgatgttctggaccagatgggcgccagt
atcctgggcgtggagggcccccggcgccacccagatgagccccctgaggatgaagtcttc
gagctcttccccatgttcatgggggggcttctctctgcccacaaccgagctgtgctagct
cagcttggctgccccatcaagaacctggatgccctggagaatgcccaggccatcaagaag
aagctgggcaagctgggccggcaggtgctgcccccatcagagctccttgaccacctcttc
ttccactatgagttccagaaccagcgcttctccgctgaggtgctcagctccctgcgtcag
ctcaacctggcaggtgtgcgcatgacaccagtcaagtgcacagtggtggcagctgtgctg
ggcagcggaaggcatgccctggatgaggtgaacttggcctcctgccagctagatcctgct
gggctgcgcacactcctgcctgtcttcctgcgtgcccggaagctgggcttgcaactcaac
agcctgggccctgaggcctgcaaggacctccgagacctgttgctgcatgaccagtgccaa
attaccacactgcggctgtccaacaacccgctgacggcggcaggtgttgccgtgctaatg
gaggggctggcaggaaacacctcagtgacgcacctgtccctgctgcacacgggccttggg
gacgaaggcctggagctgctggctgcccagctggaccgcaaccggcagctgcaggagctg
aacgtggcgtacaacggtgctggtgacacagcggccctggccctggccagagctgcccgg
gagcacccttccctggaactgctacacctctacttcaatgagctgagctcagagggccgc
caggtcttgcgagacttggggggtgctgctgaaggtggtgcccgggtggtggtgtcactg
acagaggggacggcggtgtcagaatactggtcagtgatcctcagtgaagtccagcggaac
ctcaatagctgggatcgggcccgggttcagcgacaccttgagctcctactgcgggatctg
gaagatagccggggtgccacccttaatccttggcgcaaggcccagctgctgcgagtggag
ggcgaggtcagggccctcctggagcagctgggaagctctggaagctga

DBGET integrated database retrieval system