KEGG   Homo sapiens (human): 79679Help
Entry
79679             CDS       T01001                                 

Gene name
VTCN1, B7-H4, B7H4, B7S1, B7X, B7h.5, PRO1291, VCTN1
Definition
V-set domain containing T cell activation inhibitor 1
Orthology
K06747  
immune costimulatory protein B7-H4
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:hsa04514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p13.1
AA seq 187 aa AA seqDB search
MFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEV
NVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLY
NVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKASLCVSSFFAISWALLPL
SPYLMLK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaggccggacagcagtgtttgctgatcaagtgatagttggcaatgcctctttg
cggctgaaaaacgtgcaactcacagatgctggcacctacaaatgttatatcatcacttct
aaaggcaaggggaatgctaaccttgagtataaaactggagccttcagcatgccggaagtg
aatgtggactataatgccagctcagagaccttgcggtgtgaggctccccgatggttcccc
cagcccacagtggtctgggcatcccaagttgaccagggagccaacttctcggaagtctcc
aataccagctttgagctgaactctgagaatgtgaccatgaaggttgtgtctgtgctctac
aatgttacgatcaacaacacatactcctgtatgattgaaaatgacattgccaaagcaaca
ggggatatcaaagtgacagaatcggagatcaaaaggcggagtcacctacagctgctaaac
tcaaaggcttctctgtgtgtctcttctttctttgccatcagctgggcacttctgcctctc
agcccttacctgatgctaaaataa

DBGET integrated database retrieval system