KEGG   Homo sapiens (human): 79705Help
Entry
79705             CDS       T01001                                 

Gene name
LRRK1, RIPK6, Roco1
Definition
(RefSeq) leucine rich repeat kinase 1 (EC:2.7.11.1)
  KO
K08843  
leucine-rich repeat kinase 1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     79705 (LRRK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  LRRK family
   79705 (LRRK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q26.3
AA seq 2015 aa AA seqDB search
MAGMSQRPPSMYWCVGPEESAVCPERAMETLNGAGDTGGKPSTRGGDPAARSRRTEGIRA
AYRRGDRGGARDLLEEACDQCASQLEKGQLLSIPAAYGDLEMVRYLLSKRLVELPTEPTD
DNPAVVAAYFGHTAVVQELLESLPGPCSPQRLLNWMLALACQRGHLGVVKLLVLTHGADP
ESYAVRKNEFPVIVRLPLYAAIKSGNEDIAIFLLRHGAYFCSYILLDSPDPSKHLLRKYF
IEASPLPSSYPGKTALRVKWSHLRLPWVDLDWLIDISCQITELDLSANCLATLPSVIPWG
LINLRKLNLSDNHLGELPGVQSSDEIICSRLLEIDISSNKLSHLPPGFLHLSKLQKLTAS
KNCLEKLFEEENATNWIGLRKLQELDISDNKLTELPALFLHSFKSLNSLNVSRNNLKVFP
DPWACPLKCCKASRNALECLPDKMAVFWKNHLKDVDFSENALKEVPLGLFQLDALMFLRL
QGNQLAALPPQEKWTCRQLKTLDLSRNQLGKNEDGLKTKRIAFFTTRGRQRSGTEAASVL
EFPAFLSESLEVLCLNDNHLDTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQL
DTEDLTISNVPAEIQKEGPKAMLSYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQT
GRAPQVVHGEATIRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALY
VVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLA
LCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAG
RLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFL
IETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVG
TGFTQQTEEQYFQFLAKFEIALPVANDSYLLPHLLPSKPGLDTHGMRHPTANTIQRVFKM
SFVPVGFWQRFIARMLISLAEMDLQLFENKKNTKSRNRKVTIYSFTGNQRNRCSTFRVKR
NQTIYWQEGLLVTFDGGYLSVESSDVNWKKKKSGGMKIVCQSEVRDFSAMAFITDHVNSL
IDQWFPALTATESDGTPLMEQYVPCPVCETAWAQHTDPSEKSEDVQYFDMEDCVLTAIER
DFISCPRHPDLPVPLQELVPELFMTDFPARLFLENSKLEHSEDEGSVLGQGGSGTVIYRA
RYQGQPVAVKRFHIKKFKNFANVPADTMLRHLRATDAMKNFSEFRQEASMLHALQHPCIV
ALIGISIHPLCFALELAPLSSLNTVLSENARDSSFIPLGHMLTQKIAYQIASGLAYLHKK
NIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIV
YDEKVDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFRRLQALMM
ECWDTKPEKRPLALSVVSQMKDPTFATFMYELCCGKQTAFFSSQGQEYTVVFWDGKEESR
NYTVVNTEKGLMEVQRMCCPGMKVSCQLQVQRSLWTATEDQKIYIYTLKGMCPLNTPQQA
LDTPAVVTCFLAVPVIKKNSYLVLAGLADGLVAVFPVVRGTPKDSCSYLCSHTANRSKFS
IADEDARQNPYPVKAMEVVNSGSEVWYSNGPGLLVIDCASLEICRRLEPYMAPSMVTSVV
CSSEGRGEEVVWCLDDKANSLVMYHSTTYQLCARYFCGVPSPLRDMFPVRPLDTEPPAAS
HTANPKVPEGDSIADVSIMYSEELGTQILIHQESLTDYCSMSSYSSSPPRQAARSPSSLP
SSPASSSSVPFSTDCEDSDMLHTPGAASDRSEHDLTPMDGETFSQHLQAVKILAVRDLIW
VPRRGGDVIVIGLEKDSGAQRGRVIAVLKARELTPHGVLVDAAVVAKDTVVCTFENENTE
WCLAVWRGWGAREFDIFYQSYEELGRLEACTRKRR
NT seq 6048 nt NT seq  +upstreamnt  +downstreamnt
atggctggcatgtcgcaaagaccccccagcatgtactggtgtgtggggccggaggagtca
gctgtgtgtccagaacgtgccatggagacgcttaacggtgccggggacacgggcggcaag
ccgtccacgcggggcggtgaccctgcagcgcggtcccgcaggacggaaggcatccgcgcc
gcgtacaggcggggagaccgcggcggcgcccgggacctgctggaggaggcctgcgaccag
tgcgcgtcccagctggaaaagggccagcttctgagcatcccggcagcctatggggatctg
gagatggtccgctacctactcagcaagagactggtggagctgcccaccgagcccacggat
gacaacccagccgtggtggcagcgtattttggacacacggcagttgtgcaggaattgctt
gagtccttaccaggtccctgcagtccccagcggcttctgaactggatgctggccttggct
tgccagcgagggcacctgggggttgtgaagctcctggtcctgacgcacggggctgacccg
gagagctacgctgtcaggaagaatgagttccctgtcatcgtgcgcttgcccctgtatgcg
gccatcaagtcagggaatgaagacattgcaatattcctgcttcggcatggggcctatttc
tgttcctacatcttgctggatagtcctgaccccagcaaacatctgctgagaaagtacttc
attgaagccagtcccttgcccagcagttatccgggaaaaacagctctccgtgtgaaatgg
tcccatctcagactgccctgggtagacctagactggctcatagacatctcctgccagatc
acggagctcgacctttctgccaactgcctggcgaccctcccctcggttatcccctggggc
ctcatcaatctccggaagctgaacctctccgacaaccacctgggggagctgcctggcgtg
cagtcatcggacgaaatcatctgttccaggctacttgaaattgacatttccagcaacaag
ttgtcccacctccctcctggattcttgcacctctcaaaacttcaaaaactgacagcttca
aaaaattgtttagaaaaattgttcgaagaagaaaatgccactaactggataggtttacgg
aagctacaggaacttgatatatctgacaataaattgacagaactccctgccctgttcctt
cactctttcaagtccctcaattctctgaatgtctccagaaacaacctgaaggtgtttcca
gatccctgggcctgccctttgaaatgttgtaaagcttccagaaatgccctggaatgtctg
ccagacaaaatggctgtcttttggaaaaatcacctgaaggatgtggatttctcagaaaac
gcactcaaagaagttcccctgggacttttccagcttgatgccctcatgttcttgaggtta
caggggaaccagctggcggcacttccacctcaagagaagtggacctgcaggcagctcaaa
accctggatctctccagaaaccaacttggcaaaaatgaagatggactgaaaacgaagcgt
attgcctttttcaccaccagaggtcgccagcgctccgggactgaggcagcaagtgtgctg
gaatttccggccttcctaagtgagtctttggaagtcctttgcctgaacgacaaccacctc
gacacagtccctccctcggtttgcctactgaagagcttatcagagctctacttgggaaac
aaccctggcctccgggagctccctcctgagctggggcagctgggcaacctctggcagctg
gacactgaagacctgaccatcagcaatgtgcctgcagaaatccaaaaagaaggccccaaa
gcaatgctgtcttacctgcgtgctcagctgcggaaagcggaaaagtgcaagctgatgaag
atgatcatcgtgggtcccccgcgccagggcaagtccaccctcctggagatcttacagacg
gggagggccccccaggtggtgcatggagaggccaccatcaggaccaccaagtgggagctc
cagaggccggctggctcgagagccaaggttgagtccgtggagttcaacgtctgggacatc
gggggaccggccagcatggccactgtcaaccagtgcttcttcacggacaaggccctgtac
gtggtggtctggaacctggcgctgggggaggaggccgtggccaacctccagttctggctg
ctcaacatcgaggccaaggccccaaacgccgtggtgctggtggtcgggacgcacctggat
ttaattgaagccaagttccgtgtggaaaggattgcaacgctgcgtgcctatgtgctggca
ctctgccgctccccctccggctccagggccacaggcttcccagacatcaccttcaaacac
ttacatgagatttcctgcaagagcctggaaggtcaggaagggctgcgacagctgattttc
cacgtcacgtgcagcatgaaggacgtgggcagcaccatcggctgccagcgactggcaggg
cggctgatccccaggagctacctgagcctgcaggaggccgtgctggcagagcagcagcgc
cgcagccgggacgacgacgtgcagtacctgacggacaggcagctggagcagctggtggag
cagacgcccgacaacgacatcaaggactacgaggacctgcagtcagccatcagcttcctc
atagaaaccggcaccctgctccatttcccggacaccagccacggcctgaggaacctctac
ttcctcgaccctatttggctctccgaatgtctgcagaggatctttaatattaagggctct
cggtcagtggccaagaatggggtgatcagagcagaagacctcaggatgctgctggtgggg
actggcttcacgcagcagacggaagagcagtacttccagttcctggccaagtttgagatc
gccctgcccgtcgccaatgacagctacctcctgccccatctccttccatctaaacctggc
ctggacacccacggtatgcggcaccccacagccaacaccattcagagggtatttaagatg
agcttcgttcccgttggcttctggcaaaggtttatagcacggatgctgatcagcctggcg
gagatggacctgcagctttttgaaaacaagaagaatactaaaagcaggaacaggaaagtc
accatttacagttttacaggaaaccagagaaatcgctgtagcacattcagagtgaaaaga
aatcagaccatctattggcaggaagggctcctggtcacttttgatgggggctacctcagt
gtggaatcttccgacgtgaactggaaaaagaagaaaagcggaggaatgaaaattgtttgc
caatcagaagtgagggacttctcagccatggctttcatcacggaccacgtcaattccttg
attgatcagtggtttcccgccctgacagccacagagagcgacgggacgccactcatggag
cagtacgtgccctgcccggtctgcgagacagcctgggcccagcacacggaccccagtgag
aaatcagaggatgtgcagtacttcgacatggaagactgtgtcctgacggccatcgagcgg
gacttcatctcctgccccagacacccggacctccccgtgccgctgcaggagctggtccct
gaactgttcatgaccgacttcccggccaggctcttcctggagaacagcaagctggagcac
agcgaggacgagggcagcgtcctgggccagggcggcagtggcaccgtcatctaccgggcc
cggtaccagggccagcctgtggccgtcaagcgcttccacatcaaaaaattcaagaacttt
gctaacgtaccggcagacaccatgctgaggcacctgcgggccaccgatgccatgaagaac
ttctccgagttccggcaggaggccagcatgctgcacgcgctgcagcacccctgcatcgtg
gcgctcatcggcatcagcatccacccgctctgcttcgccctggagctcgcgccgctcagc
agcctcaacaccgtgctgtccgagaacgccagagattcttcctttatacccctgggacac
atgctcacccaaaaaatagcctaccagatcgcctcgggcctggcctacctgcacaagaaa
aacatcatcttctgtgacctgaagtcggacaacattctggtgtggtcccttgacgtcaag
gagcacatcaacatcaagctatctgactacgggatttcgaggcagtcattccatgagggc
gccctaggcgtggagggcactcctggctaccaggccccagagatcaggcctcgcattgta
tatgatgagaaggtagatatgttctcctatggaatggtgctctacgagttgctgtcagga
cagcgccctgcactgggccaccaccagctccagattgccaagaagctgtccaagggcatc
cgcccggttctggggcagccggaggaagtgcagttccggcgactgcaggcgctcatgatg
gagtgctgggacactaagccagagaagcgaccgctggccctgtcggtggtgagccagatg
aaggacccgacttttgccaccttcatgtatgaactgtgctgtgggaagcagacagccttc
ttctcatcccagggccaggagtacaccgtggtgttttgggatggaaaagaggagtccagg
aactacacggtggtgaacacagagaagggcctcatggaggtgcagaggatgtgctgccct
gggatgaaggtgagctgccagctccaggtccagagatccctgtggacagccaccgaggac
cagaaaatctacatctacaccctcaagggcatgtgccccttaaacacaccccaacaggcc
ttggatactccagctgtcgtcacctgcttcttggccgtgcctgttattaaaaagaattcc
tacctggtcttagcgggcctcgccgatgggcttgtggctgtgtttcccgtggtgcggggc
accccaaaggacagctgctcctacctgtgctcacacacagccaacaggtccaagttcagc
atcgcggatgaagacgcacggcagaacccctacccagtgaaggccatggaggtggtcaac
agcggctctgaggtctggtacagcaatgggccgggcctccttgtcatcgactgtgcctcc
ctggagatctgcaggcggctggagccctacatggccccctccatggttacgtcagtcgtg
tgcagctctgagggcagaggggaggaggtcgtctggtgcctggatgacaaggccaactcc
ttggtgatgtaccactccaccacctaccagctgtgtgcccggtacttctgcggggtcccc
agccccctcagggacatgtttcccgtgcggcccttggacacggaacccccggcagccagc
cacacggccaacccaaaggtgcctgagggggactccatcgcggacgtgagcatcatgtac
agtgaggagctgggcacgcagatcctgatccaccaggaatcactcactgactactgctcc
atgtcctcctactcctcatccccaccccgccaggctgccaggtccccctcaagcctcccc
agctccccagcaagttcttccagtgtgcctttctccaccgactgcgaggactcagacatg
ctacatacgcccggtgctgcctccgacaggtctgagcatgacctgacccccatggacggg
gagaccttcagccagcacctgcaggccgtgaagatcctcgccgtcagagacctcatttgg
gtccccaggcgcggtggagatgttatcgtcattggcctggagaaggattctggcgcccag
cggggccgagtcattgccgtcttaaaagcccgagagctgactccgcatggggtgctggtg
gatgctgccgtggtggcaaaggacactgttgtgtgcacctttgaaaatgaaaacacagag
tggtgcctggccgtctggaggggctggggcgccagggagttcgacattttctaccagtcc
tacgaggagctgggccggctggaggcttgcactcgcaagagaaggtaa

DBGET integrated database retrieval system