KEGG   Homo sapiens (human): 79720Help
Entry
79720             CDS       T01001                                 

Gene name
VPS37B
Definition
vacuolar protein sorting 37 homolog B (S. cerevisiae)
Orthology
K12185  
ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-I complex
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 285 aa AA seqDB search
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
LYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRL
PELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQC
PPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgggagcgaagcccggttcgccgggctgtcgctggtgcagctcaacgag
ctgctggaggacgagggccagctgacggagatggtgcagaagatggaggagacacagaat
gttcagcttaacaaagaaatgacacttgccagcaaccggagcctggcagaaggaaacctt
ttgtaccagccccagctggacacgttgaaagcacgcttgacccagaaataccaggaactc
caggttctctttgaagcctatcagataaagaagaccaaattagacagacagtctagcagt
gcttccttggagaccctgttagcacttcttcaggcagaaggggccaagattgaggaagac
actgagaacatggcagagaagtttctggatggagaacttcctctggattccttcattgat
gtctatcagagcaaacggaaactggcccacatgcgacgggtgaaaatcgagaagctccag
gagatggtcctaaaggggcagagactcccacaggccctggccccgctgccccccaggctg
cccgaactggcacctaccgccccccttccctaccctgccccagaggccagtgggcctcct
gccgttgcacctcggcgcatcccccccccaccacccccggtgcctgcgggacgcttagcc
accccgtttactgcggccatgagttcgggacaggccgtgccgtacccaggattacagtgc
ccgcccctgcccccccgcgtgggcctccccactcagcaaggattctcttcgcagttcgtg
tccccatatccgccacctctccctcagagacccccgccccggctccctccacaccagccg
ggtttcatcctccagtga

DBGET integrated database retrieval system