KEGG   Homo sapiens (human): 79720Help
Entry
79720             CDS       T01001                                 

Gene name
VPS37B
Definition
(RefSeq) VPS37B, ESCRT-I subunit
  KO
K12185  ESCRT-I complex subunit VPS37
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Module
hsa_M00409  ESCRT-I complex
Network
N00183  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    79720 (VPS37B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    79720 (VPS37B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   79720 (VPS37B)
  Exosomal proteins of colorectal cancer cells
   79720 (VPS37B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mod_r Tex_N CENP-F_N
Motif
Other DBs
NCBI-GeneID: 79720
NCBI-ProteinID: NP_078943
OMIM: 610037
HGNC: 25754
Ensembl: ENSG00000139722
Vega: OTTHUMG00000168767
Pharos: Q9H9H4(Tbio)
UniProt: Q9H9H4 A0A024RBU0
Position
12q24.31
AA seq 285 aa AA seqDB search
MAGAGSEARFAGLSLVQLNELLEDEGQLTEMVQKMEETQNVQLNKEMTLASNRSLAEGNL
LYQPQLDTLKARLTQKYQELQVLFEAYQIKKTKLDRQSSSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDSFIDVYQSKRKLAHMRRVKIEKLQEMVLKGQRLPQALAPLPPRL
PELAPTAPLPYPAPEASGPPAVAPRRIPPPPPPVPAGRLATPFTAAMSSGQAVPYPGLQC
PPLPPRVGLPTQQGFSSQFVSPYPPPLPQRPPPRLPPHQPGFILQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgggagcgaagcccggttcgccgggctgtcgctggtgcagctcaacgag
ctgctggaggacgagggccagctgacggagatggtgcagaagatggaggagacacagaat
gttcagcttaacaaagaaatgacacttgccagcaaccggagcctggcagaaggaaacctt
ttgtaccagccccagctggacacgttgaaagcacgcttgacccagaaataccaggaactc
caggttctctttgaagcctatcagataaagaagaccaaattagacagacagtctagcagt
gcttccttggagaccctgttagcacttcttcaggcagaaggggccaagattgaggaagac
actgagaacatggcagagaagtttctggatggagaacttcctctggattccttcattgat
gtctatcagagcaaacggaaactggcccacatgcgacgggtgaaaatcgagaagctccag
gagatggtcctaaaggggcagagactcccacaggccctggccccgctgccccccaggctg
cccgaactggcacctaccgccccccttccctaccctgccccagaggccagtgggcctcct
gccgttgcacctcggcgcatcccccccccaccacccccggtgcctgcgggacgcttagcc
accccgtttactgcggccatgagttcgggacaggccgtgccgtacccaggattacagtgc
ccgcccctgcccccccgcgtgggcctccccactcagcaaggattctcttcgcagttcgtg
tccccatatccgccacctctccctcagagacccccgccccggctccctccacaccagccg
ggtttcatcctccagtga

DBGET integrated database retrieval system