KEGG   Homo sapiens (human): 7976Help
Entry
7976              CDS       T01001                                 

Gene name
FZD3, Fz-3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  
frizzled 3
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Axon guidance
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Human papillomavirus infection
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Basal cell carcinoma
Breast cancer
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7976 (FZD3)
   04390 Hippo signaling pathway
    7976 (FZD3)
   04150 mTOR signaling pathway
    7976 (FZD3)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7976 (FZD3)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7976 (FZD3)
  Development
   04360 Axon guidance
    7976 (FZD3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7976 (FZD3)
   05206 MicroRNAs in cancer
    7976 (FZD3)
   05205 Proteoglycans in cancer
    7976 (FZD3)
   05217 Basal cell carcinoma
    7976 (FZD3)
   05224 Breast cancer
    7976 (FZD3)
  Infectious diseases
   05166 HTLV-I infection
    7976 (FZD3)
   05165 Human papillomavirus infection
    7976 (FZD3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    7976 (FZD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9NPG1(Tbio)
UniProt: 
Position
8p21.1
AA seq 666 aa AA seqDB search
MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctatgacttggattgtcttctctctttggcccttgactgtgttcatggggcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagctttg
gcaatggagccattccaccctatggtgaatctggattgttctcgggatttccggcctttt
ctttgtgcactctacgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggagaaccaactgaaggagccccagtggcagtgcagagagac
tatggtttttggtgtccccgagagttaaaaattgatcctgatctgggttattcttttctg
catgtgcgtgattgttcacctccttgtccaaatatgtacttcagaagagaagaactgtca
tttgctcgctatttcataggattgatttcaatcatttgcctctcggccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctacatgatggtatccttaattttcttcattggatttttgcttgaagat
cgagtagcctgcaatgcatccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatgatactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccccgga
actctaaccatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagtttatgatccgg
atcggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccggggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacttgattctcttt
ctgatgaaatacctgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtctctcctgagggatcca
aatactcctatcataagaaagtcaaggggaacttccactcaaggaacatccacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcaggaagcatccacagc
aaagtgagcagctaccacggcagcctccacagatcacgtgatggcaggtacacgccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactaacagatcac
tccaggcatagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcatatcacacatggcaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

DBGET integrated database retrieval system