KEGG   Homo sapiens (human): 7976Help
Entry
7976              CDS       T01001                                 

Gene name
FZD3, Fz-3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  frizzled 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing's syndrome
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    7976 (FZD3)
   04390 Hippo signaling pathway
    7976 (FZD3)
   04150 mTOR signaling pathway
    7976 (FZD3)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7976 (FZD3)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    7976 (FZD3)
  Development
   04360 Axon guidance
    7976 (FZD3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7976 (FZD3)
   05206 MicroRNAs in cancer
    7976 (FZD3)
   05205 Proteoglycans in cancer
    7976 (FZD3)
   05225 Hepatocellular carcinoma
    7976 (FZD3)
   05226 Gastric cancer
    7976 (FZD3)
   05217 Basal cell carcinoma
    7976 (FZD3)
   05224 Breast cancer
    7976 (FZD3)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    7976 (FZD3)
  Infectious diseases
   05166 HTLV-I infection
    7976 (FZD3)
   05165 Human papillomavirus infection
    7976 (FZD3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    7976 (FZD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz DUF898
Motif
Other DBs
NCBI-GeneID: 7976
NCBI-ProteinID: NP_059108
OMIM: 606143
HGNC: 4041
Ensembl: ENSG00000104290
Vega: OTTHUMG00000102145
Pharos: Q9NPG1(Tbio)
UniProt: Q9NPG1
Position
8p21.1
AA seq 666 aa AA seqDB search
MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggctatgacttggattgtcttctctctttggcccttgactgtgttcatggggcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagctttg
gcaatggagccattccaccctatggtgaatctggattgttctcgggatttccggcctttt
ctttgtgcactctacgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggagaaccaactgaaggagccccagtggcagtgcagagagac
tatggtttttggtgtccccgagagttaaaaattgatcctgatctgggttattcttttctg
catgtgcgtgattgttcacctccttgtccaaatatgtacttcagaagagaagaactgtca
tttgctcgctatttcataggattgatttcaatcatttgcctctcggccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctacatgatggtatccttaattttcttcattggatttttgcttgaagat
cgagtagcctgcaatgcatccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatgatactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccccgga
actctaaccatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagtttatgatccgg
atcggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccggggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacttgattctcttt
ctgatgaaatacctgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtctctcctgagggatcca
aatactcctatcataagaaagtcaaggggaacttccactcaaggaacatccacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcaggaagcatccacagc
aaagtgagcagctaccacggcagcctccacagatcacgtgatggcaggtacacgccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactaacagatcac
tccaggcatagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcatatcacacatggcaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

DBGET integrated database retrieval system