KEGG   Homo sapiens (human): 7979Help
Entry
7979              CDS       T01001                                 

Gene name
SEM1, C7orf76, DSS1, ECD, SHFD1, SHFM1, SHSF1, Shfdg1
Definition
(RefSeq) SEM1, 26S proteasome complex subunit
  KO
K10881  
26 proteasome complex subunit DSS1
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Homologous recombination
Epstein-Barr virus infection
Module
Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    7979 (SEM1)
  Replication and repair
   03440 Homologous recombination
    7979 (SEM1)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    7979 (SEM1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    7979 (SEM1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     7979 (SEM1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     7979 (SEM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P60896(Tbio)
UniProt: 
Position
7q21.3
AA seq 128 aa AA seqDB search
MYCQDSNICAVFAVQGGKVGRKHGIKRGRRPSIRSPAQRARGPWIHESKHPAFAKQQINL
EMPNSRATTELAWVCSSTSRKKKWARSLTLSTAPLSPPPSLVHCEDCSCLPGCHSGDLYN
LAPAERTC
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtattgccaggactccaacatttgtgctgtgtttgctgtacaaggaggaaaagtggga
agaaagcatggcataaaaagggggaggagacccagcataagaagcccagctcagcgggcc
agaggaccctggatccatgagagtaagcatccggcctttgcaaagcaacagataaacttg
gagatgcccaactccagagcgacaacagagttagcctgggtctgcagctccacctcaaga
aaaaagaagtgggcaaggtccctgactctttccactgctccactgagccccccaccatcc
ttggtgcactgtgaagattgttcttgcctgcctggctgccattcgggtgacctctacaat
ctggccccagcagaaagaacttgctag

DBGET integrated database retrieval system