KEGG   Homo sapiens (human): 79814Help
Entry
79814             CDS       T01001                                 

Gene name
AGMAT
Definition
agmatine ureohydrolase (agmatinase) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Position
1p36.21
AA seq 352 aa AA seqDB search
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMM
RLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLM
VADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVG
LLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
ALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggctgctggcgtccgggtgcgcccggggcccggggcccggcgtgggcgcgcgt
cctgccgcagggctctttcatccggggcgccgccagagccgccaggcttccgacgcgccc
cggaaccagccccccagccccgagttcgtggcccggccggtgggcgtctgctccatgatg
cgcctgccggtgcagacctcccccgaggggctggacgctgccttcatcggggtgcccctg
gatactgggacctccaaccggcctggggcgagattcggacctcgccgcatccgggaagaa
tcagtgatgcttgggacagtcaatcctagcacgggggccctccccttccagtccctcatg
gttgcagacctaggcgatgtgaatgtcaatctttacaaccttcaggacagctgccggcga
attcaagaggcctatgagaaaattgtagcagctggctgtattcctctgaccttgggtgga
gatcacacaatcacatatcccatattgcaagcgatggcaaaaaagcatggcccagtgggg
ctgctgcacgtggatgcgcacacggacacgaccgacaaggccctaggagagaagctctac
cacggggcgcccttccgccggtgtgtggatgagggtctcctggactgtaagcgtgtggtg
cagattggcatccggggctcttccacgaccttggatccctacagatacaaccggagccag
ggcttccgggtagtcctggctgaagactgctggatgaagtcgctggttcctctgatgggg
gaagtcaggcagcagatgggaggcaaacccatttatatcagctttgatattgacgctctg
gatcctgcctatgcgccagggacagggacacctgaaattgctggtctcactcctagtcag
gctctggagatcatcaggggttgtcaaggcctgaacgtgatgggctgtgatcttgtcgaa
gtttcaccaccgtatgatctttctgggaacacagccctgctggcggctaacctgctgttt
gagatgctatgtgctctccccaaagtgacaaccgtctga

DBGET integrated database retrieval system