KEGG   Homo sapiens (human): 79814Help
Entry
79814             CDS       T01001                                 

Gene name
AGMAT
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Module
hsa_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    79814 (AGMAT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     79814 (AGMAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 79814
NCBI-ProteinID: NP_079034
OMIM: 617887
HGNC: 18407
Ensembl: ENSG00000116771
Vega: OTTHUMG00000002357
Pharos: Q9BSE5(Tdark)
UniProt: Q9BSE5 A0A024QZ78
Position
1p36.21
AA seq 352 aa AA seqDB search
MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMM
RLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLM
VADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGDHTITYPILQAMAKKHGPVG
LLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIRGSSTTLDPYRYNRSQ
GFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
ALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggctgctggcgtccgggtgcgcccggggcccggggcccggcgtgggcgcgcgt
cctgccgcagggctctttcatccggggcgccgccagagccgccaggcttccgacgcgccc
cggaaccagccccccagccccgagttcgtggcccggccggtgggcgtctgctccatgatg
cgcctgccggtgcagacctcccccgaggggctggacgctgccttcatcggggtgcccctg
gatactgggacctccaaccggcctggggcgagattcggacctcgccgcatccgggaagaa
tcagtgatgcttgggacagtcaatcctagcacgggggccctccccttccagtccctcatg
gttgcagacctaggcgatgtgaatgtcaatctttacaaccttcaggacagctgccggcga
attcaagaggcctatgagaaaattgtagcagctggctgtattcctctgaccttgggtgga
gatcacacaatcacatatcccatattgcaagcgatggcaaaaaagcatggcccagtgggg
ctgctgcacgtggatgcgcacacggacacgaccgacaaggccctaggagagaagctctac
cacggggcgcccttccgccggtgtgtggatgagggtctcctggactgtaagcgtgtggtg
cagattggcatccggggctcttccacgaccttggatccctacagatacaaccggagccag
ggcttccgggtagtcctggctgaagactgctggatgaagtcgctggttcctctgatgggg
gaagtcaggcagcagatgggaggcaaacccatttatatcagctttgatattgacgctctg
gatcctgcctatgcgccagggacagggacacctgaaattgctggtctcactcctagtcag
gctctggagatcatcaggggttgtcaaggcctgaacgtgatgggctgtgatcttgtcgaa
gtttcaccaccgtatgatctttctgggaacacagccctgctggcggctaacctgctgttt
gagatgctatgtgctctccccaaagtgacaaccgtctga

DBGET integrated database retrieval system