KEGG   Homo sapiens (human): 79825Help
Entry
79825             CDS       T01001                                 

Gene name
EFCC1, C3orf73, CCDC48
Definition
EF-hand and coiled-coil domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21.3
AA seq 598 aa AA seqDB search
MEPVSTGAEAGMEGAGGDPYRRPARRTQWLLSALAHHYGLDRGVENEIVVLATGLDQYLQ
EVFHHLDCRGAGRLPRADFRALCAVLGLRAEGATTAGQAAGDGNSRDVTPGDAAAELATD
GDSDTDEEARLALRAEPPELTFRQFHARLCGYFGTRAGPRLPRGALSEHIETQIRLRRPR
RRRRPPCAPGPDSGPDCERVARLEEENSSLRELVEDLRAALQSSDARCLALQVGLWKSQA
STHEMGHGGPEAAVRELRQAQGALAAAEARAGRLRRGQAEVRRRAEEARQVVLRSLHRVR
ELEALAQQVPGLQRWVRRLEAELQRYRSEDSQLPTPQLANPEPGDKSNEPEDAGTRDPDP
TPEGAWQSDSSSGSRALDEVDEQLFRSVEGQAASDEEEVEEERWQEEKKTPAAEAKTLLA
RLSSCRGRCDDQTAEKLMTYFGHFGGANHAHTLGELEACIAMLVEQLRTQGCGGRTLGTS
EEEAELQQKVEENEHLRLELQMVETERVRLSLLEEKLVDVLQLLQRLRDLNISKRALGKI
LLSTLDAFRDPTHEGRPSPAAILDALHQALAACQLLRRQPSAPASAAAALTNPLLVSC
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggagccggtcagcacgggcgcggaggccggcatggagggcgcgggaggtgacccgtac
cggcgacctgcgcggcgcacgcagtggctgctgagcgccctggcgcaccactacgggctg
gaccgcggcgtggagaacgagatcgtggtgctggccaccggcctggaccagtacctgcag
gaggtcttccaccacctggactgccgcggcgccggccgtctgccccgcgccgacttccga
gcgctctgcgctgtgctggggctgcgcgcggagggggccaccacggccgggcaggcagca
ggtgacgggaactccagagatgtgacccccggggatgcggccgctgagttggccacggac
ggggactcagataccgatgaagaggcgcgcctggcgctgcgcgccgagccgccggagctc
accttccgccagttccacgcgcgcctctgtggctacttcggcacccgtgcggggccccgg
ctgccccgcggcgctctcagcgagcacatcgagacgcagatccgcctgcgccgtccgcgc
cgccgccgccgcccgccctgcgcgcctggccccgacagcggtcctgactgtgagcgcgtt
gcgcggctggaggaggagaatagcagcttgcgcgagttggtggaggacctgcgcgccgcg
ctgcagagcagtgatgcgcgctgcctagcactgcaggtcggactctggaagagccaggcg
agcacccacgagatggggcacggcgggccggaggctgcggtgcgggagctgcgtcaggcg
cagggcgccctggctgcggcggaggcccgcgctgggcggctgcgccgtggccaggccgag
gtgcggcggcgcgcggaggaggcccggcaggtggtgctgcgcagcctgcaccgcgtgcga
gagctggaggcgctggcgcaacaggtgcccggcttgcagcgctgggtgcggcggctggag
gcggagctgcaacgctacaggtcagaggattcccagctcccaaccccgcagctagccaac
ccagagccaggagacaagagtaatgaacctgaagatgctgggaccagagacccagacccc
actccagagggagcctggcagtcagacagcagctctggaagcagagccctggatgaagtg
gacgagcagctgttccgctccgtggagggccaggccgcctctgacgaggaggaggtggag
gaggagaggtggcaggaggagaagaagacgccggcagccgaggccaagacactgctggcc
cggctctccagctgcagaggcaggtgtgatgaccagacggcggagaagctcatgacttac
tttggtcacttcggcggtgccaaccatgcccataccctgggggagctggaggcctgcatt
gccatgctggtggagcagctgaggactcagggctgcggtgggaggaccctggggacctct
gaggaggaggcagagttgcagcagaaggtggaagagaatgagcacctgaggctggagctg
cagatggtagagaccgagagggtgcggctgtccctgctggaggagaagctggtggacgtg
ctgcagctcctgcagaggctccgggacctgaacatatcgaaaagagccctggggaagatt
ttgctgagcacgctggacgctttcagggaccccacccacgagggaaggcccagccctgca
gccatcctggatgccctgcaccaagccttggctgcctgccagctgttgcggagacagccc
tcggcaccagcctctgcagcagctgcgctcaccaaccccctcctcgtctcctgctga

DBGET integrated database retrieval system