KEGG   Homo sapiens (human): 79837Help
Entry
79837             CDS       T01001                                 

Gene name
PIP4K2C, PIP5K2C
Definition
phosphatidylinositol-5-phosphate 4-kinase, type II, gamma (EC:2.7.1.149)
Orthology
K00920  
1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    79837 (PIP4K2C)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    79837 (PIP4K2C)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    79837 (PIP4K2C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     79837 (PIP4K2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.3
AA seq 421 aa AA seqDB search
MASSSVPPATVSAATAGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHLFHRENLPSHFKFKEYCPQVFRNLRDRFGIDDQ
DYLVSLTRNPPSESEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVDNEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKIFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEA
PVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFITNIF
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcctcctcggtcccaccagccacggtatcggcggcgacagcaggccccggccca
ggtttcggcttcgcctccaagaccaagaagaagcatttcgtgcagcagaaggtgaaggtg
ttccgggcggccgacccgctggtgggtgtgttcctgtggggcgtagcccactcgatcaat
gagctcagccaggtgcctcccccggtgatgctgctgccagatgactttaaggccagctcc
aagatcaaggtcaacaatcaccttttccacagggaaaatctgcccagtcatttcaagttc
aaggagtattgtccccaggtcttcaggaacctccgtgatcgatttggcattgatgaccaa
gattacttggtgtcccttacccgaaacccccccagcgaaagtgaaggcagtgatggtcgc
ttccttatctcctacgatcggactctggtcatcaaagaagtatccagtgaggacattgct
gacatgcatagcaacctctccaactatcaccagtacattgtgaagtgccatggcaacacg
cttctgccccagttcctggggatgtaccgagtcagtgtggacaacgaagacagctacatg
cttgtgatgcgcaatatgtttagccaccgtcttcctgtgcacaggaagtatgacctcaag
ggttccctagtgtcccgggaagccagcgataaggaaaaggttaaagaattgcccaccctt
aaggatatggactttctcaacaagaaccagaaagtatatattggtgaagaggagaagaaa
atatttctggagaagctgaagagagatgtggagtttctagtgcagctgaagatcatggac
tacagccttctgctaggcatccacgacatcattcggggctctgaaccagaggaggaagcg
cccgtgcgggaggatgagtcagaggtggatggggactgcagcctgactggacctcctgct
ctggtgggctcctatggcacctccccagagggtatcggaggctacatccattcccatcgg
cccctgggcccaggagagtttgagtccttcattgatgtctatgccatccggagtgctgaa
ggagccccccagaaggaggtctacttcatgggcctcattgatatccttacacagtatgat
gccaagaagaaagcagctcatgcagccaaaactgtcaagcatggggctggggcagagatc
tctactgtccatccggagcagtatgctaagcgattcctggattttattaccaacatcttt
gcctaa

DBGET integrated database retrieval system